Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   GPA00_RS08420 Genome accession   NZ_CP046629
Coordinates   1709247..1709687 (-) Length   146 a.a.
NCBI ID   WP_157328329.1    Uniprot ID   -
Organism   Streptococcus equinus strain CNU G6     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1694018..1724918 1709247..1709687 within 0


Gene organization within MGE regions


Location: 1694018..1724918
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GPA00_RS08365 (GPA00_08365) - 1694018..1694863 (+) 846 WP_157328316.1 aldo/keto reductase -
  GPA00_RS08370 (GPA00_08370) - 1694914..1697862 (-) 2949 WP_157328318.1 type III restriction-modification system endonuclease -
  GPA00_RS08375 (GPA00_08375) - 1697876..1699966 (-) 2091 WP_157328321.1 site-specific DNA-methyltransferase -
  GPA00_RS08380 (GPA00_08380) - 1700416..1701639 (-) 1224 WP_024343970.1 ATP-binding protein -
  GPA00_RS08385 (GPA00_08385) - 1701647..1702327 (-) 681 WP_024343969.1 response regulator transcription factor -
  GPA00_RS08390 (GPA00_08390) - 1702343..1702960 (-) 618 WP_134775331.1 GTP pyrophosphokinase family protein -
  GPA00_RS08395 (GPA00_08395) - 1703050..1703232 (-) 183 Protein_1588 ABC transporter permease -
  GPA00_RS08400 (GPA00_08400) - 1703237..1703686 (-) 450 WP_157328322.1 MarR family winged helix-turn-helix transcriptional regulator -
  GPA00_RS09770 - 1703689..1705560 (-) 1872 WP_198362624.1 hypothetical protein -
  GPA00_RS08410 (GPA00_08410) rcrQ 1705667..1707439 (-) 1773 WP_157328325.1 ABC transporter ATP-binding protein Regulator
  GPA00_RS08415 (GPA00_08415) rcrP 1707429..1709243 (-) 1815 WP_157328327.1 ABC transporter ATP-binding protein Regulator
  GPA00_RS08420 (GPA00_08420) rcrR 1709247..1709687 (-) 441 WP_157328329.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  GPA00_RS08425 (GPA00_08425) - 1709835..1710245 (-) 411 WP_157328331.1 peptide deformylase -
  GPA00_RS08430 (GPA00_08430) - 1710248..1710751 (-) 504 WP_157328333.1 GNAT family N-acetyltransferase -
  GPA00_RS08435 (GPA00_08435) gdhA 1710904..1712253 (-) 1350 WP_021142476.1 NADP-specific glutamate dehydrogenase -
  GPA00_RS08440 (GPA00_08440) - 1712483..1712980 (+) 498 WP_157328335.1 DUF308 domain-containing protein -
  GPA00_RS09775 queF 1713019..1713510 (-) 492 WP_021142478.1 preQ(1) synthase -
  GPA00_RS09780 queE 1713526..1714239 (-) 714 WP_198362625.1 7-carboxy-7-deazaguanine synthase QueE -
  GPA00_RS08450 (GPA00_08450) queD 1714232..1714678 (-) 447 WP_027968631.1 6-carboxytetrahydropterin synthase QueD -
  GPA00_RS08455 (GPA00_08455) queC 1714678..1715331 (-) 654 WP_157328336.1 7-cyano-7-deazaguanine synthase QueC -
  GPA00_RS08460 (GPA00_08460) - 1715497..1717266 (-) 1770 WP_024343958.1 ABC transporter ATP-binding protein -
  GPA00_RS08465 (GPA00_08465) - 1717269..1719008 (-) 1740 WP_157328338.1 ABC transporter ATP-binding protein -
  GPA00_RS08470 (GPA00_08470) - 1719053..1720921 (-) 1869 WP_157328340.1 ABC-F family ATP-binding cassette domain-containing protein -
  GPA00_RS08475 (GPA00_08475) - 1720918..1722123 (-) 1206 WP_024343955.1 CCA tRNA nucleotidyltransferase -
  GPA00_RS08480 (GPA00_08480) dapB 1722120..1722887 (-) 768 WP_157328342.1 4-hydroxy-tetrahydrodipicolinate reductase -
  GPA00_RS08485 (GPA00_08485) - 1722911..1723759 (-) 849 WP_157328344.1 DegV family protein -
  GPA00_RS08490 (GPA00_08490) - 1723759..1724139 (-) 381 WP_021142489.1 DUF1149 family protein -
  GPA00_RS08495 (GPA00_08495) - 1724259..1724918 (-) 660 WP_157328346.1 glucosaminidase domain-containing protein -

Sequence

Protein


Download         Length: 146 a.a.        Molecular weight: 17010.52 Da        Isoelectric Point: 7.4036

>NTDB_id=406325 GPA00_RS08420 WP_157328329.1 1709247..1709687(-) (rcrR) [Streptococcus equinus strain CNU G6]
MRDKDPFSQLRDFVNLMENRVHELGELHDVENLAGPQGFAVLYLRDNEDKEVFIKDIERKLKISKSVTSNLIKRMEKNGF
IKVVPSEVDKRYKRVVLTELGQAKTKDIDAFHAAVHKQIFDGISREELEISGRVFDRILKNLENKE

Nucleotide


Download         Length: 441 bp        

>NTDB_id=406325 GPA00_RS08420 WP_157328329.1 1709247..1709687(-) (rcrR) [Streptococcus equinus strain CNU G6]
ATGCGAGATAAAGATCCGTTTTCACAATTAAGAGACTTTGTTAATTTGATGGAAAACCGTGTGCACGAACTCGGTGAACT
TCATGATGTGGAGAACTTAGCTGGTCCGCAGGGGTTTGCGGTTTTATATTTGAGAGATAATGAAGATAAAGAAGTTTTCA
TTAAAGATATTGAACGTAAGCTTAAAATTTCAAAATCTGTAACCAGTAATTTGATTAAAAGAATGGAAAAGAATGGTTTT
ATAAAAGTTGTTCCATCTGAAGTAGATAAACGTTACAAGCGTGTAGTGCTTACTGAACTTGGTCAAGCTAAGACAAAAGA
TATTGATGCTTTTCACGCTGCGGTTCACAAGCAAATTTTTGATGGCATTAGTCGTGAAGAGCTAGAAATTTCTGGTCGTG
TCTTTGATCGTATTTTGAAAAATTTAGAAAACAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(35-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

53.147

97.945

0.521

Multiple sequence alignment