Detailed information    

insolico Bioinformatically predicted

Overview

Name   spo0J   Type   Regulator
Locus tag   GO995_RS00320 Genome accession   NZ_CP046624
Coordinates   58940..59722 (+) Length   260 a.a.
NCBI ID   WP_074965479.1    Uniprot ID   -
Organism   Streptococcus ruminicola strain CNU_G3     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 27276..65066 58940..59722 within 0


Gene organization within MGE regions


Location: 27276..65066
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GO995_RS00145 (GO995_00145) - 27276..27944 (-) 669 WP_074564679.1 transglycosylase SLT domain-containing protein -
  GO995_RS00150 (GO995_00150) - 28196..28801 (-) 606 WP_074561052.1 LysM peptidoglycan-binding domain-containing protein -
  GO995_RS00155 (GO995_00155) - 29050..30213 (-) 1164 WP_238385876.1 tyrosine-type recombinase/integrase -
  GO995_RS00160 (GO995_00160) - 30326..30892 (-) 567 WP_074863843.1 helix-turn-helix domain-containing protein -
  GO995_RS00165 (GO995_00165) - 31058..31246 (+) 189 WP_074863844.1 transcriptional regulator -
  GO995_RS00170 (GO995_00170) - 31309..31962 (+) 654 WP_157628596.1 Rha family transcriptional regulator -
  GO995_RS00175 (GO995_00175) - 32298..32492 (+) 195 WP_157628597.1 hypothetical protein -
  GO995_RS09445 - 32504..32650 (+) 147 WP_202913538.1 hypothetical protein -
  GO995_RS00180 (GO995_00180) - 32647..32841 (+) 195 WP_074863972.1 hypothetical protein -
  GO995_RS00185 (GO995_00185) - 32855..33130 (+) 276 WP_081341086.1 hypothetical protein -
  GO995_RS00190 (GO995_00190) - 33127..34023 (+) 897 WP_157628598.1 primase alpha helix C-terminal domain-containing protein -
  GO995_RS00195 (GO995_00195) - 34036..35553 (+) 1518 WP_157628599.1 DNA primase family protein -
  GO995_RS00200 (GO995_00200) - 35844..35999 (+) 156 WP_157628600.1 hypothetical protein -
  GO995_RS00205 (GO995_00205) - 36019..36216 (+) 198 WP_157628601.1 hypothetical protein -
  GO995_RS00210 (GO995_00210) - 36209..36649 (+) 441 WP_157628602.1 hypothetical protein -
  GO995_RS00215 (GO995_00215) - 37475..37888 (+) 414 WP_074450704.1 DUF1492 domain-containing protein -
  GO995_RS00220 (GO995_00220) - 38366..39160 (-) 795 WP_157628603.1 energy-coupling factor transporter transmembrane component T family protein -
  GO995_RS00225 (GO995_00225) - 39153..39995 (-) 843 WP_074564705.1 energy-coupling factor ABC transporter ATP-binding protein -
  GO995_RS00230 (GO995_00230) - 39971..40810 (-) 840 WP_157628604.1 energy-coupling factor ABC transporter ATP-binding protein -
  GO995_RS00235 (GO995_00235) pgsA 40807..41361 (-) 555 WP_039696094.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  GO995_RS00240 (GO995_00240) - 41374..42324 (-) 951 WP_157628605.1 helix-turn-helix domain-containing protein -
  GO995_RS00245 (GO995_00245) yfmH 42390..43679 (-) 1290 WP_157628606.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  GO995_RS00250 (GO995_00250) yfmF 43680..44924 (-) 1245 WP_006531474.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  GO995_RS00255 (GO995_00255) yaaA 45011..45382 (+) 372 WP_162307921.1 S4 domain-containing protein YaaA -
  GO995_RS00260 (GO995_00260) recF 45385..46479 (+) 1095 WP_157628608.1 DNA replication/repair protein RecF -
  GO995_RS00265 (GO995_00265) - 46545..47411 (-) 867 WP_074603194.1 GRP family sugar transporter -
  GO995_RS00270 (GO995_00270) guaB 47656..49137 (-) 1482 WP_133017769.1 IMP dehydrogenase -
  GO995_RS00275 (GO995_00275) trpS 49362..50384 (-) 1023 WP_039696086.1 tryptophan--tRNA ligase -
  GO995_RS00280 (GO995_00280) - 50855..51727 (+) 873 WP_074564718.1 YitT family protein -
  GO995_RS00285 (GO995_00285) - 51821..53443 (+) 1623 WP_004233679.1 ATP-binding cassette domain-containing protein -
  GO995_RS00290 (GO995_00290) - 53538..56114 (+) 2577 WP_157628609.1 YfhO family protein -
  GO995_RS00310 (GO995_00310) rlmH 56933..57412 (-) 480 WP_074564722.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  GO995_RS00315 (GO995_00315) htrA 57628..58881 (+) 1254 WP_157628610.1 S1C family serine protease Regulator
  GO995_RS00320 (GO995_00320) spo0J 58940..59722 (+) 783 WP_074965479.1 ParB/RepB/Spo0J family partition protein Regulator
  GO995_RS00325 (GO995_00325) dnaA 59926..61281 (+) 1356 WP_157628611.1 chromosomal replication initiator protein DnaA -
  GO995_RS00330 (GO995_00330) dnaN 61440..62576 (+) 1137 WP_039696079.1 DNA polymerase III subunit beta -
  GO995_RS00335 (GO995_00335) - 62707..63591 (+) 885 WP_157628612.1 diacylglycerol/lipid kinase family protein -
  GO995_RS00340 (GO995_00340) - 63602..63796 (+) 195 WP_157628613.1 DUF951 domain-containing protein -
  GO995_RS00345 (GO995_00345) - 63946..64722 (+) 777 WP_157628614.1 CPBP family intramembrane glutamic endopeptidase -
  GO995_RS00350 (GO995_00350) - 64734..65066 (+) 333 WP_234794879.1 helix-turn-helix domain-containing protein -

Sequence

Protein


Download         Length: 260 a.a.        Molecular weight: 29828.63 Da        Isoelectric Point: 9.6238

>NTDB_id=406135 GO995_RS00320 WP_074965479.1 58940..59722(+) (spo0J) [Streptococcus ruminicola strain CNU_G3]
MIETLNLIPIDDIAPNPYQPRLKFKQEELEELSRSIKANGLIQPIIVRKSDIFGYELIAGERRLKASKMAGLSEIPAIIK
DITNKESMQLAIVENLQRSDLNPIEEAKAYQQLLDKNQMTHEELAQFMGKSRPYITNCLRLLNLPTIISHAVEKGELSQG
HARVLLTLKDEKEQEKWYQKILSEDMSVRKLEQAVKSTKKKKTSSKVSKKDIFIRHQEEELSKLLGLPVTLSLSKSGFKG
DLQLHFQSEEDLNRIINRLK

Nucleotide


Download         Length: 783 bp        

>NTDB_id=406135 GO995_RS00320 WP_074965479.1 58940..59722(+) (spo0J) [Streptococcus ruminicola strain CNU_G3]
ATGATTGAAACACTTAATCTCATACCTATTGACGATATTGCTCCAAATCCTTACCAACCTCGCTTGAAATTTAAGCAAGA
AGAATTAGAAGAACTTTCTCGCTCAATAAAAGCAAACGGCCTCATACAGCCGATAATCGTACGTAAATCAGATATTTTTG
GTTACGAGCTCATTGCAGGAGAAAGACGTCTTAAAGCATCAAAAATGGCTGGTTTAAGCGAAATTCCTGCAATTATAAAA
GATATTACTAATAAAGAAAGCATGCAGCTTGCCATTGTCGAAAATTTGCAGCGCTCTGATCTCAATCCTATTGAAGAAGC
CAAGGCTTATCAGCAATTGCTCGATAAAAACCAAATGACTCACGAAGAGTTGGCACAATTTATGGGAAAATCACGACCAT
ATATCACTAATTGCTTGCGCTTATTGAATTTACCGACGATTATTTCTCATGCCGTCGAAAAAGGTGAACTTTCTCAAGGA
CACGCGCGTGTGCTGCTGACACTTAAGGACGAAAAAGAGCAGGAGAAGTGGTACCAAAAAATTCTGAGCGAAGATATGAG
CGTTCGCAAACTCGAACAAGCTGTAAAATCTACTAAAAAGAAAAAAACATCTTCTAAAGTAAGCAAAAAAGATATTTTTA
TCCGTCATCAAGAAGAAGAATTATCAAAATTATTAGGTCTCCCTGTCACCTTATCACTTTCTAAAAGTGGCTTTAAAGGA
GACTTACAATTACATTTTCAATCAGAAGAAGACTTAAACAGAATTATCAACAGGCTAAAATAG

Domains

Predicted by InterproScan.

ParB/Sulfiredoxin domain (ParB_N)

(8-95)

HTH domain found in ParB protein (HTH_ParB)

(148-196)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  spo0J Streptococcus mutans UA159

61.538

100

0.615

Multiple sequence alignment