Detailed information    

insolico Bioinformatically predicted

Overview

Name   recD2   Type   Machinery gene
Locus tag   SELSP_RS12465 Genome accession   NC_015437
Coordinates   1096377..1096610 (-) Length   77 a.a.
NCBI ID   WP_267878521.1    Uniprot ID   -
Organism   Selenomonas sputigena ATCC 35185     
Function   homologous recombination (predicted from homology)   
Homologous recombination

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1073756..1103533 1096377..1096610 within 0


Gene organization within MGE regions


Location: 1073756..1103533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SELSP_RS04835 (Selsp_0955) - 1073756..1075003 (+) 1248 WP_006190942.1 methionine gamma-lyase family protein -
  SELSP_RS04840 (Selsp_0956) lexA 1075081..1075695 (-) 615 WP_013740739.1 transcriptional repressor LexA -
  SELSP_RS04845 (Selsp_0957) - 1075976..1077028 (+) 1053 WP_006190933.1 restriction endonuclease -
  SELSP_RS04850 (Selsp_0958) - 1077218..1077649 (-) 432 WP_081443687.1 transposase -
  SELSP_RS12175 (Selsp_0959) - 1077675..1077785 (+) 111 Protein_967 ATP-binding protein -
  SELSP_RS04855 (Selsp_0960) - 1077918..1078223 (+) 306 WP_006190922.1 nucleotidyltransferase family protein -
  SELSP_RS04860 (Selsp_0961) - 1078220..1078585 (+) 366 WP_006190921.1 DUF86 domain-containing protein -
  SELSP_RS04865 (Selsp_0962) - 1078636..1080360 (-) 1725 WP_006190920.1 ShlB/FhaC/HecB family hemolysin secretion/activation protein -
  SELSP_RS04870 (Selsp_0963) - 1080416..1081531 (-) 1116 WP_006190919.1 hypothetical protein -
  SELSP_RS04875 (Selsp_0964) - 1081528..1082391 (-) 864 WP_006190918.1 hypothetical protein -
  SELSP_RS12440 - 1082478..1082819 (-) 342 WP_232362311.1 hypothetical protein -
  SELSP_RS12445 (Selsp_0966) - 1083085..1088664 (-) 5580 WP_006190916.1 hemagglutinin repeat-containing protein -
  SELSP_RS04890 (Selsp_0967) tnpA 1088799..1089260 (-) 462 WP_006193881.1 IS200/IS605 family transposase -
  SELSP_RS04895 (Selsp_0968) - 1089406..1089657 (+) 252 Protein_976 recombinase family protein -
  SELSP_RS04900 (Selsp_0969) - 1089758..1090744 (+) 987 WP_006190909.1 YafY family protein -
  SELSP_RS04905 (Selsp_0970) - 1090731..1091669 (+) 939 WP_006190908.1 hypothetical protein -
  SELSP_RS04910 (Selsp_0971) - 1091684..1093852 (+) 2169 WP_006190907.1 ADP-ribosylglycohydrolase family protein -
  SELSP_RS04915 (Selsp_0972) - 1093960..1094328 (+) 369 WP_006193206.1 hypothetical protein -
  SELSP_RS04920 (Selsp_0973) - 1094310..1095200 (+) 891 Protein_981 IS3 family transposase -
  SELSP_RS04925 (Selsp_0974) - 1095452..1096345 (-) 894 WP_013740742.1 hypothetical protein -
  SELSP_RS12465 (Selsp_0975) recD2 1096377..1096610 (-) 234 WP_267878521.1 ATP-binding domain-containing protein Machinery gene
  SELSP_RS04935 (Selsp_0976) - 1096756..1097094 (+) 339 WP_006190904.1 transposase -
  SELSP_RS04940 (Selsp_0977) - 1097091..1097999 (+) 909 WP_006190903.1 IS3 family transposase -
  SELSP_RS04945 (Selsp_0978) - 1098136..1098957 (-) 822 WP_013740743.1 PD-(D/E)XK nuclease family transposase -
  SELSP_RS04950 (Selsp_0979) - 1099599..1100525 (-) 927 WP_013740744.1 DUF4268 domain-containing protein -
  SELSP_RS04955 - 1100546..1100746 (-) 201 WP_006190894.1 hypothetical protein -
  SELSP_RS04960 (Selsp_0980) - 1101039..1101929 (-) 891 Protein_989 IS3 family transposase -
  SELSP_RS04965 (Selsp_0981) - 1101911..1102279 (-) 369 WP_006193206.1 hypothetical protein -
  SELSP_RS04970 (Selsp_0982) - 1102497..1103051 (+) 555 WP_006190892.1 SLATT domain-containing protein -
  SELSP_RS04975 (Selsp_0983) - 1103372..1103515 (+) 144 Protein_992 magnesium chelatase domain-containing protein -

Sequence

Protein


Download         Length: 77 a.a.        Molecular weight: 8654.32 Da        Isoelectric Point: 10.8123

>NTDB_id=40591 SELSP_RS12465 WP_267878521.1 1096377..1096610(-) (recD2) [Selenomonas sputigena ATCC 35185]
MLAYATTIHKAQGSEYPIVVMPFTMSHYVMLQRNLLYTGVTRAKKILVLVGEKKAVGMAIKNERTSVRNTKLSERLG

Nucleotide


Download         Length: 234 bp        

>NTDB_id=40591 SELSP_RS12465 WP_267878521.1 1096377..1096610(-) (recD2) [Selenomonas sputigena ATCC 35185]
GTGTTGGCGTATGCCACGACAATTCATAAGGCACAAGGTTCAGAATACCCGATCGTTGTCATGCCATTCACGATGAGTCA
TTACGTGATGTTGCAGAGAAATCTGTTATACACTGGGGTGACGAGAGCGAAGAAAATACTGGTGCTGGTTGGAGAGAAGA
AAGCTGTCGGTATGGCTATAAAGAATGAAAGGACAAGCGTTCGGAATACGAAGTTGAGTGAACGGTTGGGATGA

Domains

Predicted by InterproScan.

UvrD-like helicase C-terminal domain (UvrD_C_2)

(3-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  recD2 Bacillus subtilis subsp. subtilis str. 168

55.405

96.104

0.532
  recD Neisseria gonorrhoeae strain FA1090

36.585

100

0.39

Multiple sequence alignment