Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   GOE21_RS08195 Genome accession   NZ_CP046539
Coordinates   1583629..1584258 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain FHI_NMBU_10     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1553555..1596949 1583629..1584258 within 0


Gene organization within MGE regions


Location: 1553555..1596949
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GOE21_RS07995 (GOE21_08005) - 1556004..1557052 (-) 1049 Protein_1588 site-specific DNA-methyltransferase -
  GOE21_RS08000 (GOE21_08010) - 1557203..1557400 (-) 198 WP_000917768.1 hypothetical protein -
  GOE21_RS08005 (GOE21_08015) - 1557617..1558177 (-) 561 WP_000640044.1 DUF1133 family protein -
  GOE21_RS08010 (GOE21_08020) - 1558186..1558545 (-) 360 WP_000904153.1 RusA family crossover junction endodeoxyribonuclease -
  GOE21_RS08015 (GOE21_08025) - 1558558..1559607 (-) 1050 WP_086257807.1 DUF968 domain-containing protein -
  GOE21_RS08020 (GOE21_08030) - 1559609..1559887 (-) 279 WP_062872446.1 hypothetical protein -
  GOE21_RS08025 (GOE21_08035) - 1560069..1560350 (+) 282 WP_062872444.1 hypothetical protein -
  GOE21_RS08030 (GOE21_08040) - 1560652..1561005 (-) 354 WP_086218523.1 DUF551 domain-containing protein -
  GOE21_RS08035 (GOE21_08045) - 1561020..1561370 (-) 351 Protein_1596 hypothetical protein -
  GOE21_RS08040 (GOE21_08050) - 1561372..1561716 (-) 345 WP_086218524.1 ead/Ea22-like family protein -
  GOE21_RS08045 (GOE21_08055) - 1561703..1562032 (-) 330 WP_033815700.1 hypothetical protein -
  GOE21_RS08050 (GOE21_08060) - 1562029..1562679 (-) 651 WP_033815699.1 ead/Ea22-like family protein -
  GOE21_RS08055 (GOE21_08065) - 1562666..1562971 (-) 306 WP_001563022.1 DUF4406 domain-containing protein -
  GOE21_RS08060 (GOE21_08070) - 1562968..1563249 (-) 282 WP_172398167.1 DNA-binding protein -
  GOE21_RS08065 (GOE21_08075) - 1563282..1564043 (-) 762 WP_086257809.1 DUF1627 domain-containing protein -
  GOE21_RS08070 (GOE21_08080) - 1564077..1564538 (-) 462 WP_251302046.1 replication protein P -
  GOE21_RS08075 (GOE21_08085) - 1564531..1565541 (-) 1011 WP_062871754.1 DUF1376 domain-containing protein -
  GOE21_RS08080 (GOE21_08090) - 1565628..1566065 (-) 438 WP_000693932.1 toxin YdaT family protein -
  GOE21_RS08085 (GOE21_08095) - 1566062..1566322 (-) 261 WP_001172789.1 YdaS family helix-turn-helix protein -
  GOE21_RS08090 (GOE21_08100) - 1566449..1566841 (+) 393 WP_000578360.1 helix-turn-helix domain-containing protein -
  GOE21_RS08095 (GOE21_08105) - 1566888..1567247 (-) 360 WP_001022415.1 helix-turn-helix domain-containing protein -
  GOE21_RS08100 (GOE21_08110) - 1567250..1567552 (-) 303 WP_000692026.1 type II toxin-antitoxin system HigB family toxin -
  GOE21_RS08105 (GOE21_08115) - 1567827..1567979 (+) 153 WP_000380312.1 DUF1391 family protein -
  GOE21_RS08110 (GOE21_08120) - 1568498..1569349 (+) 852 WP_086218526.1 Rha family phage regulatory protein -
  GOE21_RS08115 (GOE21_08125) dicB 1569360..1569548 (+) 189 WP_062874719.1 cell division inhibition protein DicB -
  GOE21_RS08120 (GOE21_08130) - 1569545..1569733 (+) 189 WP_086257867.1 DUF1482 family protein -
  GOE21_RS08125 (GOE21_08135) - 1569826..1572264 (+) 2439 WP_203062548.1 exonuclease -
  GOE21_RS08130 (GOE21_08140) - 1572331..1572582 (+) 252 WP_000273163.1 DUF4224 domain-containing protein -
  GOE21_RS08135 (GOE21_08145) - 1572551..1573570 (+) 1020 WP_001367167.1 tyrosine-type recombinase/integrase -
  GOE21_RS08140 (GOE21_08150) yccA 1573978..1574637 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  GOE21_RS08145 (GOE21_08155) tusE 1574728..1575057 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  GOE21_RS08150 (GOE21_08160) yccX 1575054..1575332 (-) 279 WP_000048250.1 acylphosphatase -
  GOE21_RS08155 (GOE21_08165) rlmI 1575427..1576617 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  GOE21_RS08160 (GOE21_08170) hspQ 1576675..1576992 (+) 318 WP_001295356.1 heat shock protein HspQ -
  GOE21_RS08165 (GOE21_08175) yccU 1577037..1577450 (-) 414 WP_000665217.1 CoA-binding protein -
  GOE21_RS08170 (GOE21_08180) yccT 1577623..1578285 (+) 663 WP_000847791.1 DUF2057 family protein -
  GOE21_RS08175 (GOE21_08185) mgsA 1578381..1578839 (+) 459 WP_000424181.1 methylglyoxal synthase -
  GOE21_RS08180 (GOE21_08190) helD 1578871..1580925 (-) 2055 WP_000420533.1 DNA helicase IV -
  GOE21_RS08185 (GOE21_08195) yccF 1581048..1581494 (+) 447 WP_001261231.1 YccF domain-containing protein -
  GOE21_RS08190 (GOE21_08200) yccS 1581504..1583666 (+) 2163 WP_000875044.1 YccS family putative transporter -
  GOE21_RS08195 (GOE21_08205) sxy/tfoX 1583629..1584258 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  GOE21_RS08200 (GOE21_08210) sulA 1584477..1584986 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  GOE21_RS08205 (GOE21_08215) ompA 1585343..1586383 (+) 1041 WP_000750416.1 porin OmpA -
  GOE21_RS08210 (GOE21_08220) matP 1586459..1586911 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  GOE21_RS08215 (GOE21_08225) ycbZ 1587097..1588857 (+) 1761 WP_000156526.1 Lon protease family protein -
  GOE21_RS08220 (GOE21_08230) fabA 1588926..1589444 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  GOE21_RS08225 (GOE21_08235) rmf 1589514..1589681 (-) 168 WP_000828648.1 ribosome modulation factor -
  GOE21_RS08230 (GOE21_08240) pqiC 1589937..1590500 (-) 564 WP_000759129.1 membrane integrity-associated transporter subunit PqiC -
  GOE21_RS08235 (GOE21_08245) pqiB 1590497..1592137 (-) 1641 WP_000445534.1 intermembrane transport protein PqiB -
  GOE21_RS08240 (GOE21_08250) pqiA 1592142..1593395 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  GOE21_RS08245 (GOE21_08255) uup 1593525..1595432 (-) 1908 WP_000053089.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=405266 GOE21_RS08195 WP_000839153.1 1583629..1584258(-) (sxy/tfoX) [Escherichia coli strain FHI_NMBU_10]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=405266 GOE21_RS08195 WP_000839153.1 1583629..1584258(-) (sxy/tfoX) [Escherichia coli strain FHI_NMBU_10]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment