Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   GD442_RS20715 Genome accession   NZ_CP046398
Coordinates   4087873..4088151 (-) Length   92 a.a.
NCBI ID   WP_159365179.1    Uniprot ID   A0AAE6R1X2
Organism   Bacillus sp. A260     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4053423..4098029 4087873..4088151 within 0


Gene organization within MGE regions


Location: 4053423..4098029
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GD442_RS20460 (GD442_20465) - 4053423..4054073 (-) 651 WP_000183863.1 2OG-Fe(II) oxygenase -
  GD442_RS20465 (GD442_20470) comGG 4054248..4054619 (-) 372 WP_001231316.1 competence type IV pilus minor pilin ComGG -
  GD442_RS20470 (GD442_20475) - 4054616..4054921 (-) 306 Protein_4052 ComGF family competence protein -
  GD442_RS20475 (GD442_20480) - 4055090..4055713 (-) 624 WP_159365146.1 replication-relaxation family protein -
  GD442_RS20480 (GD442_20485) - 4055655..4056836 (-) 1182 WP_159365147.1 FtsK/SpoIIIE domain-containing protein -
  GD442_RS20485 (GD442_20490) - 4056952..4057134 (-) 183 WP_016099698.1 hypothetical protein -
  GD442_RS20490 (GD442_20495) - 4057137..4057439 (-) 303 WP_159365148.1 hypothetical protein -
  GD442_RS20495 (GD442_20500) - 4057603..4057803 (+) 201 WP_159365149.1 helix-turn-helix domain-containing protein -
  GD442_RS20500 (GD442_20505) - 4058080..4058433 (+) 354 WP_159365150.1 YolD-like family protein -
  GD442_RS20505 (GD442_20510) - 4058465..4059400 (-) 936 WP_159365151.1 N-acetylmuramoyl-L-alanine amidase -
  GD442_RS20510 (GD442_20515) - 4059400..4059825 (-) 426 WP_000373890.1 phage holin family protein -
  GD442_RS20515 (GD442_20520) - 4059865..4064499 (-) 4635 WP_159365152.1 phage tail spike protein -
  GD442_RS20520 (GD442_20525) - 4064496..4065971 (-) 1476 WP_159365153.1 distal tail protein Dit -
  GD442_RS20525 (GD442_20530) - 4066013..4068178 (-) 2166 WP_159365154.1 phage tail tape measure protein -
  GD442_RS20530 (GD442_20535) - 4068398..4068658 (-) 261 WP_098289278.1 hypothetical protein -
  GD442_RS20535 (GD442_20540) - 4068915..4070123 (-) 1209 Protein_4065 DUF2207 domain-containing protein -
  GD442_RS20540 (GD442_20545) - 4070354..4070716 (-) 363 WP_159365156.1 hypothetical protein -
  GD442_RS20545 (GD442_20550) - 4070721..4071308 (-) 588 WP_159365157.1 major tail protein -
  GD442_RS20550 (GD442_20555) - 4071309..4071638 (-) 330 WP_159365158.1 hypothetical protein -
  GD442_RS20555 (GD442_20560) - 4071638..4071979 (-) 342 WP_159365159.1 HK97 gp10 family phage protein -
  GD442_RS20560 (GD442_20565) - 4071981..4072334 (-) 354 WP_159365160.1 phage head closure protein -
  GD442_RS20565 (GD442_20570) - 4072336..4072629 (-) 294 WP_063537139.1 hypothetical protein -
  GD442_RS20570 (GD442_20575) - 4072635..4073789 (-) 1155 WP_159365161.1 phage major capsid protein -
  GD442_RS20575 (GD442_20580) - 4073793..4074575 (-) 783 WP_159365162.1 head maturation protease, ClpP-related -
  GD442_RS20580 (GD442_20585) - 4074559..4075722 (-) 1164 WP_159365163.1 phage portal protein -
  GD442_RS20585 (GD442_20590) - 4075731..4077398 (-) 1668 WP_159365164.1 terminase TerL endonuclease subunit -
  GD442_RS20590 (GD442_20595) - 4077395..4077706 (-) 312 WP_097920522.1 P27 family phage terminase small subunit -
  GD442_RS20595 (GD442_20600) - 4077830..4078165 (-) 336 WP_159365165.1 HNH endonuclease signature motif containing protein -
  GD442_RS20600 (GD442_20605) - 4078131..4078505 (-) 375 WP_159365166.1 hypothetical protein -
  GD442_RS20605 (GD442_20610) - 4078496..4078825 (-) 330 WP_159365167.1 hypothetical protein -
  GD442_RS20610 (GD442_20615) - 4078822..4079073 (-) 252 WP_159365168.1 hydrolase -
  GD442_RS20615 (GD442_20620) - 4079089..4079340 (-) 252 WP_159365169.1 hypothetical protein -
  GD442_RS20620 (GD442_20625) - 4079472..4079687 (-) 216 WP_159365170.1 hypothetical protein -
  GD442_RS28165 - 4079704..4080090 (-) 387 WP_236582421.1 hypothetical protein -
  GD442_RS20630 (GD442_20635) - 4080498..4080920 (-) 423 WP_159365171.1 hypothetical protein -
  GD442_RS20635 (GD442_20640) - 4081113..4081655 (-) 543 WP_159365172.1 site-specific integrase -
  GD442_RS20640 (GD442_20645) - 4081655..4082137 (-) 483 WP_159365173.1 ArpU family phage packaging/lysis transcriptional regulator -
  GD442_RS27840 - 4082165..4082341 (-) 177 WP_201450778.1 hypothetical protein -
  GD442_RS20645 (GD442_20650) - 4082446..4082637 (-) 192 WP_159365174.1 hypothetical protein -
  GD442_RS20650 (GD442_20655) - 4082680..4082823 (-) 144 WP_158236268.1 hypothetical protein -
  GD442_RS28290 - 4082837..4082971 (-) 135 WP_255849804.1 hypothetical protein -
  GD442_RS28170 - 4083090..4083710 (-) 621 WP_236582422.1 hypothetical protein -
  GD442_RS28175 dcm 4083742..4084786 (-) 1045 Protein_4092 DNA (cytosine-5-)-methyltransferase -
  GD442_RS20675 (GD442_20680) - 4084880..4085086 (-) 207 WP_159365175.1 hypothetical protein -
  GD442_RS27845 - 4085185..4085334 (-) 150 WP_000872736.1 hypothetical protein -
  GD442_RS20680 (GD442_20685) - 4085373..4085654 (-) 282 WP_159365176.1 hypothetical protein -
  GD442_RS20685 (GD442_20690) - 4085685..4086044 (-) 360 WP_086409326.1 YopX family protein -
  GD442_RS20690 (GD442_20695) - 4086361..4086540 (-) 180 WP_159365177.1 hypothetical protein -
  GD442_RS20695 (GD442_20700) - 4086583..4087038 (-) 456 WP_000646472.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  GD442_RS20700 (GD442_20705) - 4087058..4087309 (-) 252 WP_000109490.1 hypothetical protein -
  GD442_RS20705 (GD442_20710) - 4087335..4087502 (-) 168 WP_000717826.1 DUF3954 domain-containing protein -
  GD442_RS20710 (GD442_20715) - 4087521..4087880 (-) 360 WP_159365178.1 cell division protein SepF -
  GD442_RS20715 (GD442_20720) abrB 4087873..4088151 (-) 279 WP_159365179.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  GD442_RS20720 (GD442_20725) - 4088168..4088362 (-) 195 WP_159365180.1 hypothetical protein -
  GD442_RS20725 (GD442_20730) - 4088375..4089289 (-) 915 WP_159365181.1 AAA family ATPase -
  GD442_RS20730 (GD442_20735) - 4089304..4090170 (-) 867 WP_159365182.1 phage replisome organizer N-terminal domain-containing protein -
  GD442_RS27850 - 4090176..4090352 (-) 177 WP_000555610.1 hypothetical protein -
  GD442_RS27855 - 4090382..4090546 (-) 165 WP_201450779.1 hypothetical protein -
  GD442_RS20735 (GD442_20740) - 4090559..4090819 (-) 261 WP_016099711.1 hypothetical protein -
  GD442_RS20740 (GD442_20745) - 4090889..4091092 (-) 204 WP_159365183.1 helix-turn-helix transcriptional regulator -
  GD442_RS20745 (GD442_20750) - 4091292..4091639 (+) 348 WP_159365184.1 helix-turn-helix transcriptional regulator -
  GD442_RS27860 - 4091645..4091794 (-) 150 WP_201450780.1 hypothetical protein -
  GD442_RS20750 (GD442_20755) - 4091950..4092102 (-) 153 WP_159365185.1 hypothetical protein -
  GD442_RS20755 (GD442_20760) - 4092142..4093275 (-) 1134 WP_159365186.1 AimR family lysis-lysogeny pheromone receptor -
  GD442_RS20760 (GD442_20765) - 4093778..4094122 (+) 345 WP_073543816.1 helix-turn-helix transcriptional regulator -
  GD442_RS20765 (GD442_20770) - 4094351..4095616 (+) 1266 WP_159365187.1 hypothetical protein -
  GD442_RS20770 (GD442_20775) - 4095925..4096713 (+) 789 WP_159365188.1 hypothetical protein -
  GD442_RS20775 (GD442_20780) - 4096860..4098029 (+) 1170 WP_153598528.1 site-specific integrase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 9968.54 Da        Isoelectric Point: 7.1681

>NTDB_id=403919 GD442_RS20715 WP_159365179.1 4087873..4088151(-) (abrB) [Bacillus sp. A260]
MKNTGVSRKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGKVSESNMELLDGRMFLSKEGATEL
LGILEKSGIAHG

Nucleotide


Download         Length: 279 bp        

>NTDB_id=403919 GD442_RS20715 WP_159365179.1 4087873..4088151(-) (abrB) [Bacillus sp. A260]
ATGAAAAACACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGAGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGAACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACAGGATAAGTCATGCTTTG
TTACGGGTAAAGTTTCTGAATCAAACATGGAATTGCTGGATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA
CTAGGCATTCTTGAAAAGAGTGGAATCGCACATGGCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-48)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

57.143

91.304

0.522

Multiple sequence alignment