Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   GL183_RS08705 Genome accession   NZ_CP046355
Coordinates   1690631..1690780 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 475     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1691024..1715950 1690631..1690780 flank 244


Gene organization within MGE regions


Location: 1690631..1715950
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GL183_RS08705 (GL183_08770) cipB 1690631..1690780 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  GL183_RS08710 (GL183_08775) blpK 1691024..1691272 (-) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  GL183_RS08715 (GL183_08780) blpJ 1691341..1691610 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  GL183_RS08720 (GL183_08785) blpI 1692077..1692274 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  GL183_RS11910 comA/nlmT 1692556..1693143 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  GL183_RS08730 (GL183_08790) comA/nlmT 1693070..1694713 (+) 1644 WP_078133412.1 peptide cleavage/export ABC transporter Regulator
  GL183_RS08735 (GL183_08795) - 1694724..1696085 (+) 1362 WP_001069060.1 bacteriocin secretion accessory protein -
  GL183_RS08740 (GL183_08800) blpC 1696142..1696270 (+) 129 WP_000358815.1 quorum-sensing system pheromone BlpC -
  GL183_RS08745 (GL183_08805) - 1696452..1696781 (+) 330 WP_000132572.1 hypothetical protein -
  GL183_RS08750 (GL183_08810) - 1696949..1697998 (-) 1050 WP_000653771.1 ABC transporter permease -
  GL183_RS08755 (GL183_08815) pptA 1697995..1698726 (-) 732 WP_000889921.1 ABC transporter ATP-binding protein Regulator
  GL183_RS08760 (GL183_08820) - 1698794..1699204 (+) 411 WP_001278301.1 HIT family protein -
  GL183_RS08765 (GL183_08825) - 1699214..1699501 (+) 288 WP_000777753.1 hypothetical protein -
  GL183_RS08770 (GL183_08830) - 1699663..1699857 (+) 195 WP_001808905.1 hypothetical protein -
  GL183_RS08775 (GL183_08835) dnaJ 1700191..1701327 (-) 1137 WP_001066295.1 molecular chaperone DnaJ -
  GL183_RS08780 (GL183_08840) - 1701729..1702085 (-) 357 WP_000114422.1 hypothetical protein -
  GL183_RS08785 (GL183_08845) dnaK 1702087..1703910 (-) 1824 WP_000034662.1 molecular chaperone DnaK -
  GL183_RS08790 (GL183_08850) grpE 1704390..1704914 (-) 525 WP_000046031.1 nucleotide exchange factor GrpE -
  GL183_RS08795 (GL183_08855) hrcA 1704941..1705975 (-) 1035 WP_000255779.1 heat-inducible transcriptional repressor HrcA -
  GL183_RS08800 (GL183_08860) - 1706139..1706648 (-) 510 WP_001088689.1 DUF2812 domain-containing protein -
  GL183_RS11700 - 1706777..1706905 (+) 129 WP_001844377.1 hypothetical protein -
  GL183_RS08805 (GL183_08870) - 1707256..1709589 (+) 2334 WP_024477921.1 DEAD/DEAH box helicase family protein -
  GL183_RS08810 (GL183_08875) - 1709602..1711065 (+) 1464 WP_000029036.1 class I SAM-dependent DNA methyltransferase -
  GL183_RS08815 (GL183_08880) - 1711065..1712615 (+) 1551 WP_000187269.1 restriction endonuclease subunit S -
  GL183_RS08820 (GL183_08885) psrA 1712672..1713469 (+) 798 WP_000651177.1 tyrosine-type DNA invertase PsrA -
  GL183_RS08825 (GL183_08890) - 1713479..1714087 (+) 609 WP_000240090.1 restriction endonuclease subunit S -
  GL183_RS11915 - 1714035..1714343 (-) 309 Protein_1715 restriction endonuclease subunit S -
  GL183_RS11920 - 1714606..1715427 (-) 822 Protein_1716 restriction endonuclease subunit S -
  GL183_RS11485 (GL183_08900) - 1715801..1715950 (-) 150 WP_000410533.1 hypothetical protein -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=403058 GL183_RS08705 WP_001809846.1 1690631..1690780(-) (cipB) [Streptococcus pneumoniae strain 475]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=403058 GL183_RS08705 WP_001809846.1 1690631..1690780(-) (cipB) [Streptococcus pneumoniae strain 475]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531

Multiple sequence alignment