Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   GKC22_RS14230 Genome accession   NZ_CP046127
Coordinates   2782235..2782375 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain P48C1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2777235..2787375
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GKC22_RS14205 (GKC22_14090) - 2777501..2777890 (-) 390 WP_034659822.1 hotdog fold thioesterase -
  GKC22_RS14210 (GKC22_14095) comA 2777914..2778555 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  GKC22_RS14215 (GKC22_14100) comP 2778636..2780948 (-) 2313 WP_095285837.1 ATP-binding protein Regulator
  GKC22_RS14220 (GKC22_14105) comX 2781005..2781172 (-) 168 WP_081311380.1 competence pheromone ComX -
  GKC22_RS14225 (GKC22_14110) - 2781169..2782083 (-) 915 WP_034659828.1 polyprenyl synthetase family protein -
  GKC22_RS14230 (GKC22_14115) degQ 2782235..2782375 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  GKC22_RS14235 (GKC22_14120) - 2782881..2783234 (+) 354 WP_342689188.1 inner spore coat protein -
  GKC22_RS14240 (GKC22_14125) - 2783268..2784494 (-) 1227 WP_034659830.1 HDOD domain-containing protein -
  GKC22_RS14245 (GKC22_14130) - 2784633..2786102 (-) 1470 WP_034659831.1 nicotinate phosphoribosyltransferase -
  GKC22_RS14250 (GKC22_14135) - 2786120..2786671 (-) 552 WP_095285834.1 isochorismatase family cysteine hydrolase -
  GKC22_RS14255 (GKC22_14140) - 2786732..2787139 (-) 408 WP_034659833.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=401339 GKC22_RS14230 WP_003213123.1 2782235..2782375(-) (degQ) [Bacillus pumilus strain P48C1]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=401339 GKC22_RS14230 WP_003213123.1 2782235..2782375(-) (degQ) [Bacillus pumilus strain P48C1]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment