Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   SGGBAA2069_RS06685 Genome accession   NC_015215
Coordinates   1335844..1336284 (-) Length   146 a.a.
NCBI ID   WP_012962070.1    Uniprot ID   A0A139MWJ9
Organism   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1330578..1351812 1335844..1336284 within 0


Gene organization within MGE regions


Location: 1330578..1351812
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SGGBAA2069_RS06665 (SGGBAA2069_c12760) - 1330578..1331030 (-) 453 WP_009854390.1 MarR family winged helix-turn-helix transcriptional regulator -
  SGGBAA2069_RS06670 (SGGBAA2069_c12770) - 1331020..1331997 (-) 978 WP_013643183.1 zinc-binding dehydrogenase -
  SGGBAA2069_RS06675 (SGGBAA2069_c12780) rcrQ 1332264..1334036 (-) 1773 WP_013643184.1 ABC transporter ATP-binding protein Regulator
  SGGBAA2069_RS06680 (SGGBAA2069_c12790) rcrP 1334026..1335840 (-) 1815 WP_009854393.1 ABC transporter ATP-binding protein Regulator
  SGGBAA2069_RS06685 (SGGBAA2069_c12800) rcrR 1335844..1336284 (-) 441 WP_012962070.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  SGGBAA2069_RS06690 (SGGBAA2069_c12820) - 1336459..1336869 (-) 411 WP_013643186.1 peptide deformylase -
  SGGBAA2069_RS06695 (SGGBAA2069_c12830) - 1336866..1337375 (-) 510 WP_013643187.1 GNAT family N-acetyltransferase -
  SGGBAA2069_RS06700 (SGGBAA2069_c12840) gdhA 1337652..1339001 (-) 1350 WP_012962073.1 NADP-specific glutamate dehydrogenase -
  SGGBAA2069_RS06705 (SGGBAA2069_c12850) - 1339248..1339745 (+) 498 WP_009854399.1 DUF308 domain-containing protein -
  SGGBAA2069_RS12160 (SGGBAA2069_c12860) queF 1339802..1340293 (-) 492 WP_009854400.1 preQ(1) synthase -
  SGGBAA2069_RS12165 (SGGBAA2069_c12870) queE 1340306..1341019 (-) 714 WP_013643188.1 7-carboxy-7-deazaguanine synthase QueE -
  SGGBAA2069_RS06720 (SGGBAA2069_c12880) queD 1341012..1341458 (-) 447 WP_009854402.1 6-carboxytetrahydropterin synthase QueD -
  SGGBAA2069_RS06725 (SGGBAA2069_c12890) queC 1341464..1342111 (-) 648 WP_013643189.1 7-cyano-7-deazaguanine synthase QueC -
  SGGBAA2069_RS06730 (SGGBAA2069_c12900) - 1342353..1344122 (-) 1770 WP_009854404.1 ABC transporter ATP-binding protein -
  SGGBAA2069_RS06735 (SGGBAA2069_c12910) - 1344125..1345864 (-) 1740 WP_013643190.1 ABC transporter ATP-binding protein -
  SGGBAA2069_RS06740 (SGGBAA2069_c12920) - 1345942..1347813 (-) 1872 WP_013643191.1 ABC-F family ATP-binding cassette domain-containing protein -
  SGGBAA2069_RS06745 (SGGBAA2069_c12930) - 1347810..1349015 (-) 1206 WP_013643192.1 CCA tRNA nucleotidyltransferase -
  SGGBAA2069_RS06750 (SGGBAA2069_c12940) dapB 1349012..1349779 (-) 768 WP_013643193.1 4-hydroxy-tetrahydrodipicolinate reductase -
  SGGBAA2069_RS06755 (SGGBAA2069_c12950) - 1349799..1350647 (-) 849 WP_013643194.1 DegV family protein -
  SGGBAA2069_RS06760 (SGGBAA2069_c12960) - 1350647..1351027 (-) 381 WP_009854410.1 DUF1149 family protein -

Sequence

Protein


Download         Length: 146 a.a.        Molecular weight: 17156.66 Da        Isoelectric Point: 9.3565

>NTDB_id=40057 SGGBAA2069_RS06685 WP_012962070.1 1335844..1336284(-) (rcrR) [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
MHKKDPFSQFRDFINLMENRVHALAESHGVENLAGPQGFAVMYLRDNPDKEIYIKDIEKRLRISKSVTSNLIKRMEKNGF
IQVVSSKEDKRYKQVVLTELGKSKAQDIQDFHDEMHRQILAGVDHEDLKISFRVFDRILKNLENKE

Nucleotide


Download         Length: 441 bp        

>NTDB_id=40057 SGGBAA2069_RS06685 WP_012962070.1 1335844..1336284(-) (rcrR) [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
ATGCACAAGAAAGATCCGTTTTCACAGTTTAGGGATTTTATCAATTTAATGGAAAATCGTGTCCACGCTCTTGCGGAAAG
TCATGGTGTTGAAAATCTAGCTGGTCCACAGGGATTTGCAGTGATGTATCTTCGTGATAATCCCGATAAAGAAATTTATA
TCAAAGACATTGAGAAGAGACTAAGAATTTCAAAGTCAGTGACTAGTAATTTGATTAAGCGCATGGAGAAAAATGGTTTT
ATCCAAGTTGTTTCGTCAAAAGAAGATAAGCGTTATAAGCAAGTTGTGTTGACTGAGCTTGGAAAATCAAAGGCTCAGGA
TATTCAAGATTTCCATGATGAAATGCATAGGCAAATCTTAGCTGGTGTTGACCATGAGGATCTCAAAATCTCGTTTCGCG
TCTTTGACCGCATTTTGAAAAATTTAGAAAACAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(35-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A139MWJ9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

56.643

97.945

0.555

Multiple sequence alignment