Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | SPNINV200_RS02545 | Genome accession | NC_017593 |
| Coordinates | 481613..481762 (+) | Length | 49 a.a. |
| NCBI ID | WP_001813641.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae INV200 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 476613..486762
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPNINV200_RS02500 (SPNINV200_04710) | blpU | 478477..478707 (+) | 231 | WP_001093268.1 | bacteriocin-like peptide BlpU | - |
| SPNINV200_RS02505 | - | 478710..478829 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| SPNINV200_RS11470 (SPNINV200_04720) | - | 479126..479290 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| SPNINV200_RS02520 | - | 479287..479691 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| SPNINV200_RS11475 | - | 479889..480694 (+) | 806 | Protein_477 | IS5 family transposase | - |
| SPNINV200_RS02535 (SPNINV200_04750) | blpM | 480896..481150 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| SPNINV200_RS02540 (SPNINV200_04760) | blpN | 481166..481369 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| SPNINV200_RS02545 | cipB | 481613..481762 (+) | 150 | WP_001813641.1 | bacteriocin-like peptide BlpO | Regulator |
| SPNINV200_RS02550 (SPNINV200_04790) | - | 481866..481985 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| SPNINV200_RS02560 (SPNINV200_04810) | - | 482771..483154 (+) | 384 | WP_000877378.1 | hypothetical protein | - |
| SPNINV200_RS02565 (SPNINV200_04820) | - | 483206..483895 (+) | 690 | WP_000760541.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPNINV200_RS02570 (SPNINV200_04830) | blpZ | 483937..484170 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| SPNINV200_RS02575 (SPNINV200_04840) | - | 484321..484932 (+) | 612 | WP_000394045.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPNINV200_RS02580 (SPNINV200_04850) | ccrZ | 485093..485887 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| SPNINV200_RS02585 (SPNINV200_04860) | trmB | 485884..486519 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5164.93 Da Isoelectric Point: 3.9133
>NTDB_id=40027 SPNINV200_RS02545 WP_001813641.1 481613..481762(+) (cipB) [Streptococcus pneumoniae INV200]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=40027 SPNINV200_RS02545 WP_001813641.1 481613..481762(+) (cipB) [Streptococcus pneumoniae INV200]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
48.98 |
100 |
0.49 |