Detailed information NTG0399776

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: GJE04_RS12345
• Genome accession: NZ_CP045961
• Coordinates: 1901539..1901676 (+)
• Length: 45 a.a.
• NCBI ID: WP_192887912.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain AUSMDU00010537
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1896539..1906676

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GJE04_RS10055 (GJE04_10055)	-	1897381..1897866 (+)	486	WP_002215245.1	CinA family protein	-
GJE04_RS10060 (GJE04_10060)	msrAB	1897968..1899536 (-)	1569	WP_002216163.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-
GJE04_RS10065 (GJE04_10065)	pilA	1899682..1900947 (+)	1266	WP_002228837.1	signal recognition particle-docking protein FtsY	Machinery gene
GJE04_RS12345	pilC	1901539..1901676 (+)	138	WP_192887912.1	hypothetical protein	Machinery gene
GJE04_RS10070 (GJE04_10070)	pilC	1901640..1904705 (+)	3066	Protein_1858	PilC family type IV pilus tip adhesin	-

Sequence

Protein

• Length: 45 a.a.
• Molecular weight: 5477.54 Da
• Isoelectric Point: 12.7388

>NTDB_id=399776 GJE04_RS12345 WP_192887912.1 1901539..1901676(+) (pilC) [Neisseria meningitidis strain AUSMDU00010537]
MNKTWKRQVFRHTALYTAILMFSHTGGGGRRKRKRKRKRINTLLY

Nucleotide

• Length: 138 bp

>NTDB_id=399776 GJE04_RS12345 WP_192887912.1 1901539..1901676(+) (pilC) [Neisseria meningitidis strain AUSMDU00010537]
ATGAATAAAACTTGGAAACGGCAGGTTTTCCGCCATACCGCGCTTTATACCGCCATATTGATGTTTTCCCATACCGGCGG
GGGGGGCAGGCGCAAGCGCAAACGCAAACGCAAACGCATAAATACGCTATTGTACTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	77.778	80	0.622