Detailed information NTG0399729

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: GJE05_RS12005
• Genome accession: NZ_CP045960
• Coordinates: 1840783..1840914 (-)
• Length: 43 a.a.
• NCBI ID: WP_306808038.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain AUSMDU00005726
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1835783..1845914

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GJE05_RS09495 (GJE05_09495)	-	1837083..1837367 (-)	285	WP_002216166.1	GIY-YIG nuclease family protein	-
GJE05_RS09500 (GJE05_09500)	pilC	1837742..1840813 (-)	3072	Protein_1759	PilC family type IV pilus tip adhesin	-
GJE05_RS12005	pilC	1840783..1840914 (-)	132	WP_306808038.1	hypothetical protein	Machinery gene
GJE05_RS09505 (GJE05_09505)	pilA	1841798..1843063 (-)	1266	WP_002228837.1	signal recognition particle-docking protein FtsY	Machinery gene
GJE05_RS09510 (GJE05_09510)	msrAB	1843209..1844777 (+)	1569	WP_002216163.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-
GJE05_RS09515 (GJE05_09515)	-	1844879..1845364 (-)	486	WP_002221794.1	CinA family protein	-

Sequence

Protein

• Length: 43 a.a.
• Molecular weight: 5087.06 Da
• Isoelectric Point: 12.9102

>NTDB_id=399729 GJE05_RS12005 WP_306808038.1 1840783..1840914(-) (pilC) [Neisseria meningitidis strain AUSMDU00005726]
MNKTWKRQVFRHTALYTAILMFSHTGGGGGRRKRKRKRINTLL

Nucleotide

• Length: 132 bp

>NTDB_id=399729 GJE05_RS12005 WP_306808038.1 1840783..1840914(-) (pilC) [Neisseria meningitidis strain AUSMDU00005726]
ATGAATAAAACTTGGAAACGGCAGGTTTTCCGCCATACCGCGCTTTATACCGCCATATTGATGTTTTCCCATACCGGCGG
GGGGGGGGGCAGGCGCAAGCGCAAACGCAAACGCATAAATACGCTATTGTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	90	69.767	0.628