Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GI367_RS10650 Genome accession   NZ_CP045926
Coordinates   2234012..2234152 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain AL7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2229012..2239152
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GI367_RS10625 (GI367_10625) - 2229355..2229738 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  GI367_RS10630 (GI367_10630) comA 2229760..2230404 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  GI367_RS10635 (GI367_10635) comP 2230485..2232773 (-) 2289 WP_007613431.1 histidine kinase Regulator
  GI367_RS10640 (GI367_10640) comX 2232785..2232949 (-) 165 WP_007613432.1 competence pheromone ComX -
  GI367_RS10645 (GI367_10645) - 2232949..2233860 (-) 912 WP_007613433.1 polyprenyl synthetase family protein -
  GI367_RS10650 (GI367_10650) degQ 2234012..2234152 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  GI367_RS10655 (GI367_10655) - 2234618..2234959 (+) 342 WP_007613435.1 hypothetical protein -
  GI367_RS10660 (GI367_10660) - 2234966..2236189 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  GI367_RS10665 (GI367_10665) - 2236319..2237785 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  GI367_RS10670 (GI367_10670) - 2237803..2238354 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  GI367_RS10675 (GI367_10675) - 2238451..2238849 (-) 399 WP_007613438.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=399267 GI367_RS10650 WP_003152043.1 2234012..2234152(-) (degQ) [Bacillus velezensis strain AL7]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=399267 GI367_RS10650 WP_003152043.1 2234012..2234152(-) (degQ) [Bacillus velezensis strain AL7]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment