Detailed information
Bioinformatically predicted
Overview
| Name | pilK | Type | Machinery gene |
| Locus tag | GIJ09_RS07005 | Genome accession | NZ_CP045832 |
| Coordinates | 1284346..1284957 (-) | Length | 203 a.a. |
| NCBI ID | WP_010359922.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain AUSMDU00010541 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1232033..1298820 | 1284346..1284957 | within | 0 |
Gene organization within MGE regions
Location: 1232033..1298820
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GIJ09_RS06650 (GIJ09_06650) | - | 1232033..1232686 (-) | 654 | WP_105211373.1 | IS1595 family transposase | - |
| GIJ09_RS06655 (GIJ09_06655) | purM | 1233689..1234723 (-) | 1035 | WP_153707868.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| GIJ09_RS06660 (GIJ09_06660) | - | 1234964..1235152 (+) | 189 | WP_003689039.1 | hypothetical protein | - |
| GIJ09_RS06665 (GIJ09_06665) | - | 1235412..1236401 (+) | 990 | WP_003689040.1 | tyrosine-type recombinase/integrase | - |
| GIJ09_RS06670 (GIJ09_06670) | - | 1236743..1237222 (+) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| GIJ09_RS06675 (GIJ09_06675) | - | 1237282..1240329 (-) | 3048 | WP_153707869.1 | tape measure protein | - |
| GIJ09_RS06680 (GIJ09_06680) | - | 1240359..1240508 (-) | 150 | WP_003691402.1 | hypothetical protein | - |
| GIJ09_RS06685 (GIJ09_06685) | - | 1240820..1240993 (-) | 174 | WP_162855556.1 | hypothetical protein | - |
| GIJ09_RS06690 (GIJ09_06690) | - | 1240977..1241318 (-) | 342 | WP_003700102.1 | hypothetical protein | - |
| GIJ09_RS12270 | - | 1241302..1241460 (-) | 159 | WP_003691816.1 | hypothetical protein | - |
| GIJ09_RS06695 (GIJ09_06695) | - | 1241460..1241999 (-) | 540 | WP_047951643.1 | TIGR02594 family protein | - |
| GIJ09_RS13010 | - | 1242041..1242166 (-) | 126 | WP_255294325.1 | hypothetical protein | - |
| GIJ09_RS06700 (GIJ09_06700) | - | 1242206..1242442 (+) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| GIJ09_RS06705 (GIJ09_06705) | - | 1242442..1242789 (+) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| GIJ09_RS06710 (GIJ09_06710) | - | 1243157..1243489 (-) | 333 | WP_003691408.1 | hypothetical protein | - |
| GIJ09_RS06715 (GIJ09_06715) | - | 1243490..1243960 (-) | 471 | WP_003689057.1 | hypothetical protein | - |
| GIJ09_RS06720 (GIJ09_06720) | - | 1244031..1244336 (-) | 306 | WP_003689058.1 | hypothetical protein | - |
| GIJ09_RS06725 (GIJ09_06725) | - | 1244448..1248593 (-) | 4146 | WP_153707870.1 | phage tail protein | - |
| GIJ09_RS06730 (GIJ09_06730) | - | 1248833..1249111 (+) | 279 | WP_003692877.1 | helix-turn-helix domain-containing protein | - |
| GIJ09_RS06735 (GIJ09_06735) | - | 1249139..1249570 (-) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| GIJ09_RS06740 (GIJ09_06740) | - | 1249572..1250426 (-) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| GIJ09_RS06745 (GIJ09_06745) | - | 1250423..1251022 (-) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| GIJ09_RS06750 (GIJ09_06750) | - | 1251022..1251288 (-) | 267 | WP_003689070.1 | hypothetical protein | - |
| GIJ09_RS06755 (GIJ09_06755) | - | 1251300..1251629 (-) | 330 | WP_003689072.1 | hypothetical protein | - |
| GIJ09_RS06760 (GIJ09_06760) | - | 1251690..1252463 (-) | 774 | WP_050305212.1 | hypothetical protein | - |
| GIJ09_RS06765 (GIJ09_06765) | - | 1252489..1252917 (-) | 429 | WP_003689076.1 | hypothetical protein | - |
| GIJ09_RS06770 (GIJ09_06770) | - | 1252914..1253396 (-) | 483 | WP_003703855.1 | HK97 gp10 family phage protein | - |
| GIJ09_RS06775 (GIJ09_06775) | - | 1253396..1253926 (-) | 531 | WP_003689080.1 | head-tail connector protein | - |
| GIJ09_RS06780 (GIJ09_06780) | - | 1253929..1254291 (-) | 363 | WP_003689082.1 | hypothetical protein | - |
| GIJ09_RS06785 (GIJ09_06785) | - | 1254298..1255797 (-) | 1500 | WP_003689084.1 | hypothetical protein | - |
| GIJ09_RS06790 (GIJ09_06790) | - | 1255838..1256995 (-) | 1158 | WP_010360058.1 | HK97 family phage prohead protease | - |
| GIJ09_RS06795 (GIJ09_06795) | - | 1257063..1259210 (-) | 2148 | WP_064662124.1 | phage portal protein | - |
| GIJ09_RS06800 (GIJ09_06800) | terL | 1259207..1260628 (-) | 1422 | WP_003689090.1 | phage terminase large subunit | - |
| GIJ09_RS06805 (GIJ09_06805) | - | 1260690..1261139 (-) | 450 | WP_003695485.1 | hypothetical protein | - |
| GIJ09_RS06810 (GIJ09_06810) | - | 1261432..1262301 (-) | 870 | WP_149032486.1 | Bro-N domain-containing protein | - |
| GIJ09_RS06815 (GIJ09_06815) | - | 1262586..1263746 (-) | 1161 | WP_003691428.1 | type I restriction endonuclease | - |
| GIJ09_RS06820 (GIJ09_06820) | - | 1263837..1264244 (-) | 408 | WP_047922557.1 | hypothetical protein | - |
| GIJ09_RS13015 | - | 1264366..1264494 (+) | 129 | WP_012503747.1 | hypothetical protein | - |
| GIJ09_RS06830 (GIJ09_06830) | - | 1264511..1264891 (-) | 381 | WP_033910829.1 | RusA family crossover junction endodeoxyribonuclease | - |
| GIJ09_RS12690 | - | 1264882..1265163 (-) | 282 | WP_003689109.1 | hypothetical protein | - |
| GIJ09_RS06835 (GIJ09_06835) | - | 1265191..1265340 (-) | 150 | WP_003689110.1 | hypothetical protein | - |
| GIJ09_RS06840 (GIJ09_06840) | - | 1265517..1266011 (-) | 495 | WP_003692852.1 | DUF3310 domain-containing protein | - |
| GIJ09_RS06845 (GIJ09_06845) | - | 1266103..1266333 (-) | 231 | WP_033909710.1 | hypothetical protein | - |
| GIJ09_RS06850 (GIJ09_06850) | - | 1266350..1267711 (-) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| GIJ09_RS06855 (GIJ09_06855) | - | 1267708..1268772 (-) | 1065 | WP_003689134.1 | hypothetical protein | - |
| GIJ09_RS06860 (GIJ09_06860) | - | 1268890..1269117 (-) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| GIJ09_RS06865 (GIJ09_06865) | - | 1269290..1269478 (+) | 189 | WP_003696008.1 | hypothetical protein | - |
| GIJ09_RS06870 (GIJ09_06870) | - | 1269455..1269610 (-) | 156 | WP_048654358.1 | hypothetical protein | - |
| GIJ09_RS06875 (GIJ09_06875) | - | 1269690..1269920 (-) | 231 | WP_020997318.1 | transcriptional regulator | - |
| GIJ09_RS06880 (GIJ09_06880) | - | 1270049..1270711 (+) | 663 | WP_012503489.1 | LexA family transcriptional regulator | - |
| GIJ09_RS06885 (GIJ09_06885) | - | 1270826..1271263 (+) | 438 | WP_003687967.1 | hypothetical protein | - |
| GIJ09_RS06890 (GIJ09_06890) | - | 1271280..1271741 (+) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| GIJ09_RS06895 (GIJ09_06895) | - | 1271738..1272151 (+) | 414 | WP_003687963.1 | hypothetical protein | - |
| GIJ09_RS06900 (GIJ09_06900) | - | 1272349..1272549 (+) | 201 | WP_050161637.1 | hypothetical protein | - |
| GIJ09_RS06905 (GIJ09_06905) | - | 1272582..1273058 (+) | 477 | WP_012504141.1 | DUF6948 domain-containing protein | - |
| GIJ09_RS13020 | - | 1273055..1273186 (+) | 132 | WP_267237788.1 | hypothetical protein | - |
| GIJ09_RS06910 (GIJ09_06910) | - | 1273327..1273659 (+) | 333 | WP_153707855.1 | hypothetical protein | - |
| GIJ09_RS06915 (GIJ09_06915) | - | 1273812..1274087 (+) | 276 | WP_050156283.1 | NGO1622 family putative holin | - |
| GIJ09_RS06920 (GIJ09_06920) | - | 1274084..1274245 (+) | 162 | WP_003702497.1 | hypothetical protein | - |
| GIJ09_RS06925 (GIJ09_06925) | - | 1274314..1275000 (+) | 687 | WP_012503754.1 | phage replication initiation protein, NGO0469 family | - |
| GIJ09_RS06930 (GIJ09_06930) | - | 1275140..1275322 (+) | 183 | WP_003691535.1 | hypothetical protein | - |
| GIJ09_RS06935 (GIJ09_06935) | - | 1275319..1275810 (+) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| GIJ09_RS06940 (GIJ09_06940) | - | 1275862..1276077 (+) | 216 | WP_003691538.1 | hypothetical protein | - |
| GIJ09_RS13190 | - | 1276188..1276454 (+) | 267 | Protein_1295 | hypothetical protein | - |
| GIJ09_RS06950 (GIJ09_06950) | - | 1276735..1277418 (+) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| GIJ09_RS06955 (GIJ09_06955) | - | 1277613..1277882 (+) | 270 | WP_003687928.1 | hypothetical protein | - |
| GIJ09_RS06960 (GIJ09_06960) | - | 1278238..1279437 (-) | 1200 | WP_050155689.1 | tyrosine-type recombinase/integrase | - |
| GIJ09_RS06975 (GIJ09_06975) | yaaA | 1279968..1280747 (-) | 780 | WP_003706583.1 | peroxide stress protein YaaA | - |
| GIJ09_RS06980 (GIJ09_06980) | dapC | 1280903..1282090 (-) | 1188 | WP_149032485.1 | succinyldiaminopimelate transaminase | - |
| GIJ09_RS06985 (GIJ09_06985) | dut | 1282168..1282620 (-) | 453 | WP_010359930.1 | dUTP diphosphatase | - |
| GIJ09_RS06990 (GIJ09_06990) | - | 1282786..1283496 (+) | 711 | Protein_1302 | AzlC family ABC transporter permease | - |
| GIJ09_RS06995 (GIJ09_06995) | - | 1283493..1283801 (+) | 309 | WP_010359926.1 | AzlD family protein | - |
| GIJ09_RS07000 (GIJ09_07000) | pilL | 1283871..1284344 (-) | 474 | WP_025455985.1 | PilX family type IV pilin | Machinery gene |
| GIJ09_RS07005 (GIJ09_07005) | pilK | 1284346..1284957 (-) | 612 | WP_010359922.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| GIJ09_RS07010 (GIJ09_07010) | pilJ | 1284936..1285868 (-) | 933 | WP_153707871.1 | PilW family protein | Machinery gene |
| GIJ09_RS07015 (GIJ09_07015) | pilV | 1285865..1286476 (-) | 612 | WP_050164991.1 | type IV pilus modification protein PilV | Machinery gene |
| GIJ09_RS07020 (GIJ09_07020) | pilH | 1286508..1287173 (-) | 666 | WP_047918678.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| GIJ09_RS07025 (GIJ09_07025) | dnaB | 1287481..1288887 (-) | 1407 | WP_050164993.1 | replicative DNA helicase | - |
| GIJ09_RS07030 (GIJ09_07030) | - | 1289051..1289632 (+) | 582 | WP_003690895.1 | superoxide dismutase | - |
| GIJ09_RS07035 (GIJ09_07035) | - | 1289864..1290373 (-) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| GIJ09_RS07040 (GIJ09_07040) | - | 1290703..1291035 (-) | 333 | WP_003687908.1 | hypothetical protein | - |
| GIJ09_RS07045 (GIJ09_07045) | cysT | 1291221..1292050 (+) | 830 | Protein_1313 | sulfate ABC transporter permease subunit CysT | - |
| GIJ09_RS07050 (GIJ09_07050) | cysW | 1292239..1293099 (+) | 861 | WP_047923066.1 | sulfate ABC transporter permease subunit CysW | - |
| GIJ09_RS07055 (GIJ09_07055) | - | 1293096..1294172 (+) | 1077 | WP_003687905.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| GIJ09_RS07060 (GIJ09_07060) | ilvA | 1294228..1295754 (-) | 1527 | WP_003690890.1 | threonine ammonia-lyase, biosynthetic | - |
| GIJ09_RS07065 (GIJ09_07065) | - | 1295903..1297072 (+) | 1170 | WP_003690889.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| GIJ09_RS07070 (GIJ09_07070) | - | 1297198..1297770 (-) | 573 | WP_003687901.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| GIJ09_RS07075 (GIJ09_07075) | - | 1297837..1298820 (-) | 984 | WP_003687900.1 | ribose-phosphate pyrophosphokinase | - |
Sequence
Protein
Download Length: 203 a.a. Molecular weight: 22082.01 Da Isoelectric Point: 8.0862
>NTDB_id=398493 GIJ09_RS07005 WP_010359922.1 1284346..1284957(-) (pilK) [Neisseria gonorrhoeae strain AUSMDU00010541]
MRKQNTLTGIPTSDGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEAFGNIVVKGKPTVEAVKRSCPAKSGKNSTDLCIDNQGVEYNKGTAGVSKMP
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
MRKQNTLTGIPTSDGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEAFGNIVVKGKPTVEAVKRSCPAKSGKNSTDLCIDNQGVEYNKGTAGVSKMP
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
Nucleotide
Download Length: 612 bp
>NTDB_id=398493 GIJ09_RS07005 WP_010359922.1 1284346..1284957(-) (pilK) [Neisseria gonorrhoeae strain AUSMDU00010541]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTTCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGAAAGGCAAGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGACCTGTGCATTGACAATCAGGGAGTGGAATATAACAAAGGCACGGCAGGCGTCAGCAAAATGCCG
CGTTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTTCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGAAAGGCAAGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGACCTGTGCATTGACAATCAGGGAGTGGAATATAACAAAGGCACGGCAGGCGTCAGCAAAATGCCG
CGTTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilK | Neisseria gonorrhoeae MS11 |
94.089 |
100 |
0.941 |