Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   GII77_RS13520 Genome accession   NZ_CP045825
Coordinates   2607000..2607410 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain 75     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2602366..2628009 2607000..2607410 within 0


Gene organization within MGE regions


Location: 2602366..2628009
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII77_RS13495 (GII77_13495) yqeF 2602533..2603264 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  GII77_RS13500 (GII77_13500) cwlH 2603516..2604268 (-) 753 WP_015251672.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  GII77_RS13505 (GII77_13505) yqeD 2604455..2605081 (+) 627 WP_015251671.1 TVP38/TMEM64 family protein -
  GII77_RS13510 (GII77_13510) gnd 2605100..2605993 (-) 894 WP_015251670.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  GII77_RS13515 (GII77_13515) yqeB 2606245..2606967 (+) 723 WP_010886572.1 hypothetical protein -
  GII77_RS13520 (GII77_13520) nucA/comI 2607000..2607410 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  GII77_RS13525 (GII77_13525) - 2607606..2607956 (+) 351 Protein_2637 sigma-70 family RNA polymerase sigma factor -
  GII77_RS13530 (GII77_13530) - 2608096..2608566 (+) 471 WP_015251668.1 MarR family transcriptional regulator -
  GII77_RS13535 (GII77_13535) - 2608716..2610128 (+) 1413 WP_015251667.1 MDR family MFS transporter -
  GII77_RS13540 (GII77_13540) spoIVCA 2610315..2611775 (-) 1461 WP_235701260.1 site-specific DNA recombinase SpoIVCA -
  GII77_RS21695 - 2611733..2611911 (-) 179 Protein_2641 hypothetical protein -
  GII77_RS13545 (GII77_13545) - 2612555..2613652 (-) 1098 WP_032726210.1 glycosyl hydrolase -
  GII77_RS21700 - 2614154..2614243 (-) 90 Protein_2643 hypothetical protein -
  GII77_RS13550 (GII77_13550) - 2614585..2615712 (-) 1128 WP_015251664.1 Rap family tetratricopeptide repeat protein -
  GII77_RS21705 - 2616106..2616186 (+) 81 Protein_2645 RNA polymerase subunit sigma -
  GII77_RS13555 (GII77_13555) - 2616492..2617166 (+) 675 WP_015251663.1 TraX family protein -
  GII77_RS13560 (GII77_13560) - 2617305..2617439 (+) 135 WP_015251662.1 hypothetical protein -
  GII77_RS13565 (GII77_13565) - 2617550..2617709 (+) 160 Protein_2648 hypothetical protein -
  GII77_RS13570 (GII77_13570) - 2618079..2619845 (+) 1767 WP_015251660.1 T7SS effector LXG polymorphic toxin -
  GII77_RS13575 (GII77_13575) - 2619859..2620323 (+) 465 WP_015251659.1 SMI1/KNR4 family protein -
  GII77_RS13580 (GII77_13580) - 2620526..2621248 (-) 723 WP_015251658.1 NPP1 family protein -
  GII77_RS13585 (GII77_13585) - 2621846..2622409 (-) 564 WP_015251657.1 TetR/AcrR family transcriptional regulator -
  GII77_RS13590 (GII77_13590) - 2622607..2623494 (+) 888 WP_015251656.1 NmrA family NAD(P)-binding protein -
  GII77_RS13595 (GII77_13595) - 2623544..2624512 (-) 969 WP_015251655.1 N-acetylmuramoyl-L-alanine amidase -
  GII77_RS13600 (GII77_13600) - 2624557..2624697 (-) 141 Protein_2655 phage holin family protein -
  GII77_RS13605 (GII77_13605) - 2624724..2624909 (-) 186 Protein_2656 phage terminase large subunit -
  GII77_RS13610 (GII77_13610) terS 2624906..2625676 (-) 771 Protein_2657 phage terminase small subunit -
  GII77_RS13615 (GII77_13615) - 2625858..2625944 (+) 87 WP_073991391.1 YjcZ family sporulation protein -
  GII77_RS13620 (GII77_13620) - 2625985..2626077 (+) 93 WP_080019512.1 YjcZ family sporulation protein -
  GII77_RS13625 (GII77_13625) - 2626263..2626478 (-) 216 WP_080019511.1 CotD family spore coat protein -
  GII77_RS13630 (GII77_13630) yqaQ 2627036..2627445 (-) 410 Protein_2661 sigma factor-like helix-turn-helix DNA-binding protein -
  GII77_RS13635 (GII77_13635) - 2627743..2628009 (+) 267 WP_029318115.1 hypothetical protein -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=398316 GII77_RS13520 WP_009967785.1 2607000..2607410(-) (nucA/comI) [Bacillus subtilis strain 75]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=398316 GII77_RS13520 WP_009967785.1 2607000..2607410(-) (nucA/comI) [Bacillus subtilis strain 75]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCTGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGCTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGAGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTACGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment