Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | GII78_RS13865 | Genome accession | NZ_CP045824 |
| Coordinates | 2648579..2648989 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain MB8_B10 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2643970..2704465 | 2648579..2648989 | within | 0 |
Gene organization within MGE regions
Location: 2643970..2704465
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GII78_RS13840 (GII78_13840) | yqeF | 2644137..2644868 (-) | 732 | WP_029726702.1 | SGNH/GDSL hydrolase family protein | - |
| GII78_RS13845 (GII78_13845) | cwlH | 2645120..2645872 (-) | 753 | WP_029726701.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| GII78_RS13850 (GII78_13850) | yqeD | 2646059..2646685 (+) | 627 | WP_038427798.1 | TVP38/TMEM64 family protein | - |
| GII78_RS13855 (GII78_13855) | gnd | 2646704..2647572 (-) | 869 | Protein_2704 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| GII78_RS13860 (GII78_13860) | yqeB | 2647824..2648546 (+) | 723 | WP_010886572.1 | hypothetical protein | - |
| GII78_RS13865 (GII78_13865) | nucA/comI | 2648579..2648989 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| GII78_RS13870 (GII78_13870) | - | 2649185..2649532 (+) | 348 | Protein_2707 | sigma-70 family RNA polymerase sigma factor | - |
| GII78_RS13875 (GII78_13875) | spoIVCA | 2649563..2651023 (-) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| GII78_RS22270 | - | 2650981..2651159 (-) | 179 | Protein_2709 | hypothetical protein | - |
| GII78_RS13880 (GII78_13880) | arsC | 2651514..2651933 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| GII78_RS13885 (GII78_13885) | acr3 | 2651945..2652985 (-) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| GII78_RS13890 (GII78_13890) | arsK | 2653008..2653448 (-) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| GII78_RS13895 (GII78_13895) | arsR | 2653509..2653826 (-) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| GII78_RS13900 (GII78_13900) | yqcI | 2654198..2654962 (-) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| GII78_RS13905 (GII78_13905) | - | 2655276..2655746 (-) | 471 | WP_015714301.1 | FixH family protein | - |
| GII78_RS13910 (GII78_13910) | - | 2655775..2657138 (-) | 1364 | Protein_2716 | PepSY domain-containing protein | - |
| GII78_RS13915 (GII78_13915) | - | 2657680..2658273 (-) | 594 | WP_015714302.1 | TetR/AcrR family transcriptional regulator | - |
| GII78_RS13920 (GII78_13920) | - | 2658431..2659426 (+) | 996 | WP_015714303.1 | acryloyl-CoA reductase | - |
| GII78_RS13925 (GII78_13925) | - | 2659709..2659849 (+) | 141 | WP_231940260.1 | DUF255 domain-containing protein | - |
| GII78_RS13930 (GII78_13930) | - | 2659957..2660571 (-) | 615 | WP_153912481.1 | hypothetical protein | - |
| GII78_RS13935 (GII78_13935) | - | 2660622..2660969 (-) | 348 | WP_015714305.1 | S-Ena type endospore appendage | - |
| GII78_RS13940 (GII78_13940) | - | 2661046..2661711 (-) | 666 | WP_015714306.1 | CotZ-related putative spore coat protein | - |
| GII78_RS13945 (GII78_13945) | rapE | 2662019..2663146 (+) | 1128 | WP_015714307.1 | response regulator aspartate phosphatase RapE | - |
| GII78_RS13950 (GII78_13950) | phrE | 2663136..2663270 (+) | 135 | WP_014114495.1 | phosphatase RapE inhibitor PhrE | - |
| GII78_RS13955 (GII78_13955) | - | 2663380..2663539 (+) | 160 | Protein_2725 | hypothetical protein | - |
| GII78_RS13960 (GII78_13960) | yqcG | 2663909..2665504 (+) | 1596 | WP_015714309.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| GII78_RS13965 (GII78_13965) | yqcF | 2665519..2666097 (+) | 579 | WP_015714310.1 | type VII secretion system immunity protein YqcF | - |
| GII78_RS13970 (GII78_13970) | - | 2666215..2666361 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| GII78_RS13975 (GII78_13975) | - | 2666358..2666720 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| GII78_RS13980 (GII78_13980) | - | 2666736..2667215 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| GII78_RS13985 (GII78_13985) | cwlA | 2667380..2668198 (-) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| GII78_RS13990 (GII78_13990) | skhD | 2668243..2668665 (-) | 423 | WP_003246208.1 | holin family protein | - |
| GII78_RS13995 (GII78_13995) | xepAK | 2668710..2669603 (-) | 894 | WP_003246010.1 | hypothetical protein | - |
| GII78_RS14000 (GII78_14000) | yqcE | 2669691..2669855 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| GII78_RS14005 (GII78_14005) | yqcD | 2669852..2670187 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| GII78_RS14010 (GII78_14010) | yqcC | 2670197..2671297 (-) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| GII78_RS14015 (GII78_14015) | - | 2671300..2671572 (-) | 273 | WP_003229942.1 | hypothetical protein | - |
| GII78_RS14020 (GII78_14020) | yqcA | 2671569..2672147 (-) | 579 | WP_003229941.1 | YmfQ family protein | - |
| GII78_RS14025 (GII78_14025) | yqbT | 2672131..2673177 (-) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| GII78_RS14030 (GII78_14030) | yqbS | 2673170..2673595 (-) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| GII78_RS14035 (GII78_14035) | yqbR | 2673608..2673871 (-) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| GII78_RS14040 (GII78_14040) | yqbQ | 2673868..2674848 (-) | 981 | WP_004398524.1 | hypothetical protein | - |
| GII78_RS14045 (GII78_14045) | yqbP | 2674861..2675520 (-) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| GII78_RS14050 (GII78_14050) | yqbO | 2675513..2680270 (-) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| GII78_RS14055 (GII78_14055) | - | 2680273..2680410 (-) | 138 | WP_003229934.1 | hypothetical protein | - |
| GII78_RS14060 (GII78_14060) | - | 2680452..2680901 (-) | 450 | WP_003229933.1 | phage portal protein | - |
| GII78_RS14065 (GII78_14065) | bsrH | 2681709..2681798 (+) | 90 | WP_074794433.1 | type I toxin-antitoxin system toxin BsrH | - |
| GII78_RS14070 (GII78_14070) | yqbM | 2682170..2682613 (-) | 444 | WP_015714312.1 | phage tail tube protein | - |
| GII78_RS14075 (GII78_14075) | yqbK | 2682616..2684016 (-) | 1401 | WP_015714313.1 | phage tail sheath family protein | - |
| GII78_RS14080 (GII78_14080) | - | 2684017..2684208 (-) | 192 | WP_032679171.1 | hypothetical protein | - |
| GII78_RS14085 (GII78_14085) | yqbJ | 2684205..2684642 (-) | 438 | WP_015714315.1 | DUF6838 family protein | - |
| GII78_RS14090 (GII78_14090) | yqbI | 2684655..2685158 (-) | 504 | WP_015714316.1 | HK97 gp10 family phage protein | - |
| GII78_RS14095 (GII78_14095) | yqbH | 2685155..2685517 (-) | 363 | WP_015714317.1 | YqbH/XkdH family protein | - |
| GII78_RS14100 (GII78_14100) | gkpG | 2685514..2685909 (-) | 396 | WP_015714318.1 | DUF3199 family protein | - |
| GII78_RS14105 (GII78_14105) | yqbF | 2685914..2686225 (-) | 312 | WP_015714319.1 | YqbF domain-containing protein | - |
| GII78_RS14110 (GII78_14110) | skdG | 2686236..2687171 (-) | 936 | WP_015714320.1 | phage major capsid protein | - |
| GII78_RS14115 (GII78_14115) | yqbD | 2687190..2688164 (-) | 975 | WP_015714321.1 | XkdF-like putative serine protease domain-containing protein | - |
| GII78_RS14120 (GII78_14120) | - | 2688170..2688736 (-) | 567 | WP_015714322.1 | hypothetical protein | - |
| GII78_RS14125 (GII78_14125) | yqbB | 2688779..2689696 (-) | 918 | WP_015714323.1 | phage minor head protein | - |
| GII78_RS14130 (GII78_14130) | yqbA | 2689693..2691225 (-) | 1533 | WP_015714324.1 | phage portal protein | - |
| GII78_RS14135 (GII78_14135) | stmB | 2691229..2692524 (-) | 1296 | WP_015714325.1 | PBSX family phage terminase large subunit | - |
| GII78_RS14140 (GII78_14140) | terS | 2692517..2693236 (-) | 720 | WP_032722175.1 | phage terminase small subunit | - |
| GII78_RS14145 (GII78_14145) | - | 2693760..2693948 (-) | 189 | WP_032722176.1 | hypothetical protein | - |
| GII78_RS14150 (GII78_14150) | yqaQ | 2694093..2694548 (-) | 456 | WP_032722177.1 | hypothetical protein | - |
| GII78_RS14155 (GII78_14155) | - | 2694639..2695292 (-) | 654 | WP_032722179.1 | hypothetical protein | - |
| GII78_RS14160 (GII78_14160) | yqaO | 2695359..2695565 (-) | 207 | WP_032722180.1 | XtrA/YqaO family protein | - |
| GII78_RS14165 (GII78_14165) | yqaN | 2695647..2696075 (-) | 429 | WP_032722181.1 | RusA family crossover junction endodeoxyribonuclease | - |
| GII78_RS14170 (GII78_14170) | - | 2696171..2696320 (-) | 150 | WP_074794430.1 | hypothetical protein | - |
| GII78_RS14175 (GII78_14175) | sknM | 2696311..2697252 (-) | 942 | WP_074794427.1 | ATP-binding protein | - |
| GII78_RS14180 (GII78_14180) | yqaL | 2697134..2697811 (-) | 678 | WP_116758330.1 | DnaD domain protein | - |
| GII78_RS14185 (GII78_14185) | recT | 2697888..2698742 (-) | 855 | WP_015714338.1 | recombinase RecT | - |
| GII78_RS14190 (GII78_14190) | yqaJ | 2698745..2699716 (-) | 972 | WP_072175921.1 | YqaJ viral recombinase family protein | - |
| GII78_RS14195 (GII78_14195) | - | 2699805..2699999 (-) | 195 | WP_003229905.1 | hypothetical protein | - |
| GII78_RS14200 (GII78_14200) | - | 2699959..2700132 (-) | 174 | WP_120028409.1 | hypothetical protein | - |
| GII78_RS14205 (GII78_14205) | sknH | 2700129..2700386 (-) | 258 | WP_015714340.1 | YqaH family protein | - |
| GII78_RS14210 (GII78_14210) | yqaG | 2700383..2700952 (-) | 570 | WP_015714341.1 | helix-turn-helix transcriptional regulator | - |
| GII78_RS14215 (GII78_14215) | - | 2701026..2701166 (-) | 141 | WP_003229902.1 | hypothetical protein | - |
| GII78_RS14220 (GII78_14220) | yqaF | 2701196..2701427 (-) | 232 | Protein_2778 | helix-turn-helix transcriptional regulator | - |
| GII78_RS14225 (GII78_14225) | sknR | 2701604..2701954 (+) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
| GII78_RS14230 (GII78_14230) | - | 2702221..2702388 (-) | 168 | WP_003229900.1 | hypothetical protein | - |
| GII78_RS14235 (GII78_14235) | yqaC | 2702744..2703280 (-) | 537 | WP_004399117.1 | AAA family ATPase | - |
| GII78_RS14240 (GII78_14240) | yqaB | 2703549..2704067 (+) | 519 | WP_015714342.1 | ImmA/IrrE family metallo-endopeptidase | - |
| GII78_RS14245 (GII78_14245) | - | 2704073..2704465 (+) | 393 | Protein_2783 | sigma-70 family RNA polymerase sigma factor | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=398237 GII78_RS13865 WP_009967785.1 2648579..2648989(-) (nucA/comI) [Bacillus subtilis strain MB8_B10]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=398237 GII78_RS13865 WP_009967785.1 2648579..2648989(-) (nucA/comI) [Bacillus subtilis strain MB8_B10]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAGCAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGATAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACG
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCTGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAGCAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGATAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACG
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCTGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |