Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | INV104_RS02645 | Genome accession | NC_017591 |
| Coordinates | 508368..508517 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae INV104 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 503368..513517
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| INV104_RS02600 | blpI | 504276..504473 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| INV104_RS02605 (INV104_04500) | blpJ | 504940..505209 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| INV104_RS02610 | blpU | 505278..505508 (+) | 231 | WP_000379964.1 | bacteriocin-like peptide BlpU | - |
| INV104_RS11750 | - | 505511..505630 (+) | 120 | WP_001844187.1 | PncF family bacteriocin immunity protein | - |
| INV104_RS11755 (INV104_04510) | - | 505929..506093 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| INV104_RS02620 | - | 506090..506494 (+) | 405 | WP_000846570.1 | hypothetical protein | - |
| INV104_RS11760 | - | 506697..507501 (+) | 805 | WP_128887636.1 | IS5 family transposase | - |
| INV104_RS02635 | blpM | 507651..507905 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| INV104_RS02640 | blpN | 507921..508124 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| INV104_RS02645 | cipB | 508368..508517 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| INV104_RS02650 | - | 508621..508740 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| INV104_RS02660 (INV104_04540) | - | 509526..509910 (+) | 385 | Protein_520 | immunity protein | - |
| INV104_RS02665 (INV104_04550) | - | 509962..510651 (+) | 690 | WP_000760515.1 | CPBP family intramembrane glutamic endopeptidase | - |
| INV104_RS02670 | blpZ | 510693..510941 (+) | 249 | WP_000276500.1 | immunity protein BlpZ | - |
| INV104_RS02675 (INV104_04560) | - | 510971..511582 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| INV104_RS02680 (INV104_04570) | ccrZ | 511743..512537 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| INV104_RS02685 (INV104_04580) | trmB | 512534..513169 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=39788 INV104_RS02645 WP_001818346.1 508368..508517(+) (cipB) [Streptococcus pneumoniae INV104]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=39788 INV104_RS02645 WP_001818346.1 508368..508517(+) (cipB) [Streptococcus pneumoniae INV104]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |