Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   HR084_RS16000 Genome accession   NZ_CP054177
Coordinates   3129551..3129691 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain JCL16     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3124551..3134691
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HR084_RS15975 (HR084_15975) yuxO 3124864..3125244 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  HR084_RS15980 (HR084_15980) comA 3125263..3125907 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  HR084_RS15985 (HR084_15985) comP 3125988..3128297 (-) 2310 Protein_3108 two-component system sensor histidine kinase ComP -
  HR084_RS15990 (HR084_15990) comX 3128312..3128479 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  HR084_RS15995 (HR084_15995) comQ 3128467..3129366 (-) 900 WP_173614277.1 ComX modifying isoprenyl transferase ComQ Regulator
  HR084_RS16000 (HR084_16000) degQ 3129551..3129691 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  HR084_RS16005 (HR084_16005) - 3129913..3130038 (+) 126 WP_003228793.1 hypothetical protein -
  HR084_RS16010 (HR084_16010) - 3130152..3130520 (+) 369 WP_014477834.1 hypothetical protein -
  HR084_RS16015 (HR084_16015) pdeH 3130496..3131725 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  HR084_RS16020 (HR084_16020) pncB 3131862..3133334 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  HR084_RS16025 (HR084_16025) pncA 3133350..3133901 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  HR084_RS16030 (HR084_16030) yueI 3133998..3134396 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=397873 HR084_RS16000 WP_003220708.1 3129551..3129691(-) (degQ) [Bacillus subtilis strain JCL16]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=397873 HR084_RS16000 WP_003220708.1 3129551..3129691(-) (degQ) [Bacillus subtilis strain JCL16]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1