Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   GII90_RS12770 Genome accession   NZ_CP045811
Coordinates   2497007..2497417 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain P9_B1     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2492373..2546785 2497007..2497417 within 0


Gene organization within MGE regions


Location: 2492373..2546785
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII90_RS12745 (GII90_12745) yqeF 2492540..2493271 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  GII90_RS12750 (GII90_12750) cwlH 2493523..2494275 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  GII90_RS12755 (GII90_12755) yqeD 2494462..2495088 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  GII90_RS12760 (GII90_12760) gnd 2495107..2496000 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  GII90_RS12765 (GII90_12765) yqeB 2496252..2496974 (+) 723 WP_010886572.1 hypothetical protein -
  GII90_RS12770 (GII90_12770) nucA/comI 2497007..2497417 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  GII90_RS12775 (GII90_12775) - 2497613..2497960 (+) 348 Protein_2474 sigma-70 family RNA polymerase sigma factor -
  GII90_RS12780 (GII90_12780) spoIVCA 2497991..2499451 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  GII90_RS21095 - 2499409..2499587 (-) 179 Protein_2476 hypothetical protein -
  GII90_RS12785 (GII90_12785) arsC 2499942..2500361 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  GII90_RS12790 (GII90_12790) acr3 2500373..2501413 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  GII90_RS12795 (GII90_12795) arsK 2501436..2501876 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  GII90_RS12800 (GII90_12800) arsR 2501937..2502254 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  GII90_RS12805 (GII90_12805) yqcI 2502626..2503390 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  GII90_RS12810 (GII90_12810) rapE 2503821..2504948 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  GII90_RS12815 (GII90_12815) phrE 2504938..2505072 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  GII90_RS12820 (GII90_12820) - 2505182..2505340 (+) 159 WP_003245945.1 hypothetical protein -
  GII90_RS12825 (GII90_12825) yqcG 2505710..2507305 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  GII90_RS12830 (GII90_12830) yqcF 2507320..2507898 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  GII90_RS12835 (GII90_12835) - 2508016..2508162 (+) 147 WP_009967791.1 hypothetical protein -
  GII90_RS12840 (GII90_12840) - 2508159..2508521 (-) 363 WP_003229947.1 hypothetical protein -
  GII90_RS12845 (GII90_12845) - 2508537..2509016 (-) 480 WP_004399085.1 hypothetical protein -
  GII90_RS12850 (GII90_12850) cwlA 2509181..2509999 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  GII90_RS12855 (GII90_12855) skhD 2510044..2510466 (-) 423 WP_003246208.1 holin family protein -
  GII90_RS12860 (GII90_12860) xepAK 2510511..2511404 (-) 894 WP_003246010.1 hypothetical protein -
  GII90_RS12865 (GII90_12865) yqcE 2511492..2511656 (-) 165 WP_003229944.1 XkdX family protein -
  GII90_RS12870 (GII90_12870) yqcD 2511653..2511988 (-) 336 WP_009967793.1 XkdW family protein -
  GII90_RS12875 (GII90_12875) yqcC 2511998..2513098 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  GII90_RS12880 (GII90_12880) - 2513101..2513373 (-) 273 WP_003229942.1 hypothetical protein -
  GII90_RS12885 (GII90_12885) yqcA 2513370..2513948 (-) 579 WP_003229941.1 YmfQ family protein -
  GII90_RS12890 (GII90_12890) yqbT 2513932..2514978 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  GII90_RS12895 (GII90_12895) yqbS 2514971..2515396 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  GII90_RS12900 (GII90_12900) yqbR 2515409..2515672 (-) 264 WP_003229938.1 DUF2577 family protein -
  GII90_RS12905 (GII90_12905) yqbQ 2515669..2516649 (-) 981 WP_004398524.1 hypothetical protein -
  GII90_RS12910 (GII90_12910) emrC 2516746..2517123 (-) 378 WP_105990381.1 multidrug efflux transporter outer membrane subunit EmrC -
  GII90_RS12915 (GII90_12915) yqbP 2517432..2518091 (-) 660 WP_105990380.1 LysM peptidoglycan-binding domain-containing protein -
  GII90_RS12920 (GII90_12920) yqbO 2518084..2522835 (-) 4752 WP_153940273.1 phage tail tape measure protein -
  GII90_RS12925 (GII90_12925) - 2522838..2522975 (-) 138 WP_128753615.1 hypothetical protein -
  GII90_RS12930 (GII90_12930) - 2523017..2523466 (-) 450 WP_032722171.1 phage portal protein -
  GII90_RS21215 (GII90_12935) - 2523622..2523708 (+) 87 WP_106610765.1 putative holin-like toxin -
  GII90_RS12940 (GII90_12940) yqbM 2524045..2524488 (-) 444 WP_153940215.1 phage tail tube protein -
  GII90_RS12945 (GII90_12945) yqbK 2524491..2525891 (-) 1401 WP_153940216.1 phage tail sheath family protein -
  GII90_RS12950 (GII90_12950) - 2525892..2526083 (-) 192 WP_153940217.1 hypothetical protein -
  GII90_RS12955 (GII90_12955) yqbJ 2526080..2526517 (-) 438 WP_153940218.1 DUF6838 family protein -
  GII90_RS12960 (GII90_12960) yqbI 2526530..2527033 (-) 504 WP_153940219.1 HK97 gp10 family phage protein -
  GII90_RS12965 (GII90_12965) yqbH 2527030..2527392 (-) 363 WP_153940220.1 YqbH/XkdH family protein -
  GII90_RS12970 (GII90_12970) gkpG 2527389..2527784 (-) 396 WP_061573749.1 DUF3199 family protein -
  GII90_RS12975 (GII90_12975) yqbF 2527789..2528100 (-) 312 WP_153940221.1 YqbF domain-containing protein -
  GII90_RS12980 (GII90_12980) skdG 2528111..2529046 (-) 936 WP_003229922.1 phage major capsid protein -
  GII90_RS12985 (GII90_12985) yqbD 2529065..2530039 (-) 975 WP_153912326.1 XkdF-like putative serine protease domain-containing protein -
  GII90_RS12990 (GII90_12990) - 2530086..2530733 (-) 648 WP_044455008.1 hypothetical protein -
  GII90_RS12995 (GII90_12995) yqbB 2530773..2531690 (-) 918 WP_153912328.1 phage head morphogenesis protein -
  GII90_RS13000 (GII90_13000) yqbA 2531687..2533219 (-) 1533 WP_153912330.1 phage portal protein -
  GII90_RS13005 (GII90_13005) stmB 2533189..2534517 (-) 1329 WP_113712833.1 PBSX family phage terminase large subunit -
  GII90_RS13010 (GII90_13010) terS 2534510..2535229 (-) 720 WP_029727095.1 phage terminase small subunit -
  GII90_RS13015 (GII90_13015) - 2535378..2535572 (-) 195 WP_029727096.1 hypothetical protein -
  GII90_RS13020 (GII90_13020) - 2535959..2536525 (-) 567 WP_029727097.1 cysteine hydrolase family protein -
  GII90_RS13025 (GII90_13025) - 2536965..2537843 (-) 879 WP_153940274.1 hypothetical protein -
  GII90_RS13030 (GII90_13030) - 2537875..2538231 (-) 357 WP_019712240.1 hypothetical protein -
  GII90_RS13035 (GII90_13035) - 2538265..2538594 (-) 330 WP_029727249.1 hypothetical protein -
  GII90_RS13040 (GII90_13040) - 2539067..2539522 (-) 456 WP_029727250.1 ArpU family phage packaging/lysis transcriptional regulator -
  GII90_RS13045 (GII90_13045) - 2539782..2540048 (+) 267 WP_029727251.1 hypothetical protein -
  GII90_RS13050 (GII90_13050) yqaO 2540187..2540393 (-) 207 WP_029727252.1 XtrA/YqaO family protein -
  GII90_RS13055 (GII90_13055) yqaN 2540475..2540903 (-) 429 WP_153940275.1 RusA family crossover junction endodeoxyribonuclease -
  GII90_RS13060 (GII90_13060) - 2540999..2541148 (-) 150 WP_003229910.1 hypothetical protein -
  GII90_RS13065 (GII90_13065) sknM 2541139..2542080 (-) 942 WP_075058863.1 ATP-binding protein -
  GII90_RS13070 (GII90_13070) yqaL 2541962..2542639 (-) 678 WP_116362964.1 DnaD domain protein -
  GII90_RS13075 (GII90_13075) recT 2542715..2543569 (-) 855 WP_003229907.1 recombinase RecT -
  GII90_RS13080 (GII90_13080) yqaJ 2543572..2544531 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  GII90_RS13085 (GII90_13085) - 2544637..2544831 (-) 195 WP_003229905.1 hypothetical protein -
  GII90_RS13090 (GII90_13090) - 2544791..2544964 (-) 174 WP_119123069.1 hypothetical protein -
  GII90_RS13095 (GII90_13095) sknH 2544961..2545218 (-) 258 WP_003245994.1 YqaH family protein -
  GII90_RS13100 (GII90_13100) yqaG 2545215..2545784 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  GII90_RS13105 (GII90_13105) - 2545858..2545998 (-) 141 WP_003229902.1 hypothetical protein -
  GII90_RS13110 (GII90_13110) yqaF 2546028..2546258 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  GII90_RS13115 (GII90_13115) sknR 2546435..2546785 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=397435 GII90_RS12770 WP_009967785.1 2497007..2497417(-) (nucA/comI) [Bacillus subtilis strain P9_B1]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=397435 GII90_RS12770 WP_009967785.1 2497007..2497417(-) (nucA/comI) [Bacillus subtilis strain P9_B1]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment