Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | GE376_RS13010 | Genome accession | NZ_CP045606 |
| Coordinates | 2585015..2585293 (+) | Length | 92 a.a. |
| NCBI ID | WP_153217933.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain SB1 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2576189..2619109 | 2585015..2585293 | within | 0 |
Gene organization within MGE regions
Location: 2576189..2619109
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GE376_RS12955 (GE376_13220) | - | 2576189..2576452 (+) | 264 | WP_153217923.1 | DUF3937 family protein | - |
| GE376_RS12960 (GE376_13225) | - | 2577001..2577330 (+) | 330 | WP_001071355.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| GE376_RS31470 | - | 2577473..2577604 (+) | 132 | Protein_2520 | site-specific integrase | - |
| GE376_RS12965 (GE376_13230) | - | 2577814..2578299 (+) | 486 | WP_003270601.1 | hypothetical protein | - |
| GE376_RS12970 (GE376_13235) | - | 2578611..2579312 (+) | 702 | WP_000736206.1 | pPIWI_RE module domain-containing protein | - |
| GE376_RS12975 (GE376_13240) | - | 2579351..2580460 (-) | 1110 | WP_153217925.1 | tyrosine-type recombinase/integrase | - |
| GE376_RS12980 (GE376_13245) | - | 2581007..2582158 (+) | 1152 | WP_153217927.1 | AimR family lysis-lysogeny pheromone receptor | - |
| GE376_RS12985 (GE376_13250) | - | 2582196..2582342 (+) | 147 | WP_153217929.1 | complement C1q protein | - |
| GE376_RS32185 | - | 2582497..2582625 (+) | 129 | WP_000836783.1 | hypothetical protein | - |
| GE376_RS12990 (GE376_13255) | - | 2582663..2583016 (-) | 354 | WP_000491236.1 | helix-turn-helix domain-containing protein | - |
| GE376_RS12995 (GE376_13260) | - | 2583217..2583408 (+) | 192 | WP_000854271.1 | helix-turn-helix domain-containing protein | - |
| GE376_RS13000 (GE376_13265) | - | 2583468..2583734 (+) | 267 | WP_000522030.1 | helix-turn-helix domain-containing protein | - |
| GE376_RS31475 | - | 2583734..2583898 (+) | 165 | WP_000390287.1 | hypothetical protein | - |
| GE376_RS13005 (GE376_13270) | - | 2583956..2585011 (+) | 1056 | WP_153217931.1 | DnaD domain-containing protein | - |
| GE376_RS13010 (GE376_13275) | abrB | 2585015..2585293 (+) | 279 | WP_153217933.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| GE376_RS13015 (GE376_13280) | - | 2585286..2585645 (+) | 360 | WP_153217934.1 | cell division protein SepF | - |
| GE376_RS13020 (GE376_13285) | - | 2585664..2585831 (+) | 168 | WP_000717825.1 | DUF3954 domain-containing protein | - |
| GE376_RS13025 (GE376_13290) | - | 2585857..2586108 (+) | 252 | WP_046945297.1 | hypothetical protein | - |
| GE376_RS13030 (GE376_13295) | - | 2586128..2586595 (+) | 468 | WP_153217936.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| GE376_RS13035 (GE376_13300) | - | 2586621..2586890 (+) | 270 | WP_153217938.1 | hypothetical protein | - |
| GE376_RS13040 (GE376_13305) | - | 2586877..2587176 (-) | 300 | WP_153217940.1 | hypothetical protein | - |
| GE376_RS13045 (GE376_13310) | - | 2587312..2587842 (-) | 531 | WP_153217942.1 | GNAT family N-acetyltransferase | - |
| GE376_RS13050 (GE376_13315) | - | 2588048..2588407 (-) | 360 | WP_053564388.1 | FtsB family cell division protein | - |
| GE376_RS31480 | - | 2588717..2588857 (-) | 141 | WP_000951032.1 | hypothetical protein | - |
| GE376_RS13055 (GE376_13320) | - | 2588956..2589264 (+) | 309 | WP_153217945.1 | hypothetical protein | - |
| GE376_RS13060 (GE376_13325) | - | 2589325..2589897 (-) | 573 | WP_153217947.1 | DJ-1/PfpI family protein | - |
| GE376_RS13065 (GE376_13330) | - | 2590917..2591039 (+) | 123 | WP_000645586.1 | DUF3983 domain-containing protein | - |
| GE376_RS31485 | - | 2591155..2591325 (+) | 171 | WP_059303843.1 | hypothetical protein | - |
| GE376_RS13070 (GE376_13335) | - | 2591346..2591816 (+) | 471 | WP_153217949.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| GE376_RS13075 (GE376_13340) | - | 2591813..2592355 (+) | 543 | WP_153217950.1 | tyrosine-type recombinase/integrase | - |
| GE376_RS13080 (GE376_13345) | - | 2592480..2593136 (+) | 657 | WP_153217952.1 | hypothetical protein | - |
| GE376_RS13085 (GE376_13350) | - | 2593120..2594280 (+) | 1161 | WP_153217954.1 | helix-turn-helix domain-containing protein | - |
| GE376_RS13090 (GE376_13355) | - | 2594665..2595483 (+) | 819 | WP_098277511.1 | TIR domain-containing protein | - |
| GE376_RS13095 (GE376_13360) | - | 2595867..2596187 (+) | 321 | WP_153217956.1 | hypothetical protein | - |
| GE376_RS13100 (GE376_13365) | - | 2596216..2596431 (+) | 216 | WP_059303839.1 | hypothetical protein | - |
| GE376_RS31490 | - | 2596424..2596786 (+) | 363 | WP_198049023.1 | HNH endonuclease | - |
| GE376_RS13110 (GE376_13375) | - | 2596948..2597328 (+) | 381 | WP_000357492.1 | phage terminase small subunit P27 family | - |
| GE376_RS13115 (GE376_13380) | - | 2597309..2599081 (+) | 1773 | WP_153218330.1 | terminase large subunit | - |
| GE376_RS13120 (GE376_13385) | - | 2599097..2600299 (+) | 1203 | WP_153217958.1 | phage portal protein | - |
| GE376_RS13125 (GE376_13390) | - | 2600289..2601044 (+) | 756 | WP_153217960.1 | head maturation protease, ClpP-related | - |
| GE376_RS13130 (GE376_13395) | - | 2601041..2602228 (+) | 1188 | WP_153217962.1 | phage major capsid protein | - |
| GE376_RS13135 (GE376_13400) | - | 2602206..2602505 (+) | 300 | WP_153217964.1 | fibronectin type III domain-containing protein | - |
| GE376_RS13140 (GE376_13405) | - | 2602514..2602789 (+) | 276 | WP_000891191.1 | head-tail connector protein | - |
| GE376_RS13145 (GE376_13410) | - | 2602776..2603123 (+) | 348 | WP_001069938.1 | phage head closure protein | - |
| GE376_RS13150 (GE376_13415) | - | 2603111..2603548 (+) | 438 | WP_153217966.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| GE376_RS13155 (GE376_13420) | - | 2603545..2603904 (+) | 360 | WP_153217968.1 | structural protein | - |
| GE376_RS13160 (GE376_13425) | - | 2603918..2604502 (+) | 585 | WP_153217970.1 | major tail protein | - |
| GE376_RS13165 (GE376_13430) | gpG | 2604562..2604957 (+) | 396 | WP_046945223.1 | phage tail assembly chaperone G | - |
| GE376_RS13170 (GE376_13435) | - | 2604975..2605115 (+) | 141 | WP_153217972.1 | LysR family transcriptional regulator | - |
| GE376_RS13175 (GE376_13440) | - | 2605131..2606267 (+) | 1137 | Protein_2567 | phage tail tape measure protein | - |
| GE376_RS13180 (GE376_13445) | - | 2606603..2610406 (+) | 3804 | WP_332328479.1 | phage tail tape measure protein | - |
| GE376_RS13185 (GE376_13450) | - | 2610442..2611899 (+) | 1458 | WP_153217975.1 | distal tail protein Dit | - |
| GE376_RS13190 (GE376_13455) | - | 2611896..2617136 (+) | 5241 | WP_153217977.1 | phage tail spike protein | - |
| GE376_RS13195 (GE376_13460) | - | 2617151..2617480 (+) | 330 | WP_153217979.1 | hypothetical protein | - |
| GE376_RS13200 (GE376_13465) | - | 2617573..2617809 (+) | 237 | WP_088338580.1 | hemolysin XhlA family protein | - |
| GE376_RS13205 (GE376_13470) | - | 2617809..2618048 (+) | 240 | WP_000461723.1 | hypothetical protein | - |
| GE376_RS13210 (GE376_13475) | - | 2618045..2619109 (+) | 1065 | WP_153217982.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10143.77 Da Isoelectric Point: 5.7189
>NTDB_id=395634 GE376_RS13010 WP_153217933.1 2585015..2585293(+) (abrB) [Bacillus cereus strain SB1]
MKNTGIARKVDELGRVVIPIELRRTLGITEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
MKNTGIARKVDELGRVVIPIELRRTLGITEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=395634 GE376_RS13010 WP_153217933.1 2585015..2585293(+) (abrB) [Bacillus cereus strain SB1]
ATGAAAAATACAGGCATTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAATAGAGTTACGCAGAACTTTAGG
TATTACCGAAGGAACGGCACTAGATTTTCATGTCGATGGTGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAATACAGGCATTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAATAGAGTTACGCAGAACTTTAGG
TATTACCGAAGGAACGGCACTAGATTTTCATGTCGATGGTGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
63.218 |
94.565 |
0.598 |