Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB/nlmE   Type   Regulator
Locus tag   HPC60_RS00485 Genome accession   NZ_CP053671
Coordinates   87734..87952 (+) Length   72 a.a.
NCBI ID   WP_010905100.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain G121     
Function   transport of ComC (predicted from homology)   
Competence regulation

Genomic Context


Location: 82734..92952
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPC60_RS13880 - 83820..84443 (+) 624 WP_223848590.1 hypothetical protein -
  HPC60_RS13885 - 84738..85238 (+) 501 WP_223848591.1 HlyD family efflux transporter periplasmic adaptor subunit -
  HPC60_RS00465 (HPC60_08330) - 85332..85457 (+) 126 WP_021214955.1 lactococcin family bacteriocin -
  HPC60_RS00470 (HPC60_08335) - 85783..86151 (+) 369 WP_223848592.1 transporter -
  HPC60_RS00475 (HPC60_08340) - 86190..86846 (+) 657 WP_021214956.1 CPBP family intramembrane glutamic endopeptidase -
  HPC60_RS00480 (HPC60_13815) - 87240..87392 (-) 153 WP_010905099.1 hypothetical protein -
  HPC60_RS00485 (HPC60_08355) comB/nlmE 87734..87952 (+) 219 WP_010905100.1 hypothetical protein Regulator
  HPC60_RS00490 (HPC60_08360) - 88046..88183 (+) 138 WP_021214958.1 lactococcin family bacteriocin -
  HPC60_RS00495 (HPC60_08365) - 88377..88907 (+) 531 WP_223848593.1 CPBP family intramembrane glutamic endopeptidase -
  HPC60_RS00500 (HPC60_08370) - 89333..89785 (+) 453 WP_023189490.1 hypothetical protein -
  HPC60_RS14485 (HPC60_08375) - 89996..90154 (-) 159 WP_162182124.1 hypothetical protein -
  HPC60_RS00510 (HPC60_08380) - 90109..90657 (-) 549 WP_025016993.1 hypothetical protein -
  HPC60_RS00515 (HPC60_08385) - 90966..91145 (-) 180 WP_023163573.1 hypothetical protein -
  HPC60_RS00520 (HPC60_08390) - 91166..91345 (-) 180 WP_023163574.1 lactococcin family bacteriocin -
  HPC60_RS00525 (HPC60_08395) - 91619..91717 (+) 99 WP_223848594.1 lactococcin family bacteriocin -
  HPC60_RS00530 (HPC60_08400) - 91779..92053 (+) 275 Protein_98 hypothetical protein -
  HPC60_RS00535 (HPC60_08405) - 92248..92430 (+) 183 WP_023163576.1 hypothetical protein -
  HPC60_RS00540 (HPC60_08410) - 92432..92686 (+) 255 WP_023189493.1 hypothetical protein -

Sequence


Protein


Download         Length: 72 a.a.        Molecular weight: 8231.78 Da        Isoelectric Point: 10.5176

>NTDB_id=393317 HPC60_RS00485 WP_010905100.1 87734..87952(+) (comB/nlmE) [Lactococcus lactis subsp. lactis strain G121]
MKLTGIFLLFLIFKSFPTIFKEENAYKVSATTAINAKDLPNIRYGLQGKTVTIIGKKTYFNYFLDKIMGRTS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=393317 HPC60_RS00485 WP_010905100.1 87734..87952(+) (comB/nlmE) [Lactococcus lactis subsp. lactis strain G121]
ATGAAATTGACGGGTATATTTCTTTTATTTTTAATTTTTAAATCTTTTCCTACTATCTTTAAAGAGGAAAATGCTTATAA
AGTTTCTGCGACAACTGCTATCAATGCAAAAGACCTCCCAAATATAAGGTATGGCTTGCAAGGAAAAACGGTGACCATTA
TTGGAAAGAAAACTTATTTCAATTACTTTTTAGATAAAATTATGGGGAGGACTTCATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB/nlmE Streptococcus mutans UA159

46.429

77.778

0.361


Multiple sequence alignment