Detailed information    

insolico Bioinformatically predicted

Overview

Name   comF   Type   Machinery gene
Locus tag   GA721_RS01430 Genome accession   NZ_CP045131
Coordinates   312627..313061 (+) Length   144 a.a.
NCBI ID   WP_005180438.1    Uniprot ID   N9M7I7
Organism   Acinetobacter indicus strain TQ18     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 290747..320917 312627..313061 within 0


Gene organization within MGE regions


Location: 290747..320917
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GA721_RS01325 - 291774..292658 (+) 885 WP_160242750.1 metal-dependent hydrolase -
  GA721_RS01330 - 292824..293414 (+) 591 WP_005180484.1 LemA family protein -
  GA721_RS01335 - 293441..294505 (+) 1065 WP_160242751.1 TPM domain-containing protein -
  GA721_RS01340 - 294499..295059 (+) 561 WP_160242752.1 TPM domain-containing protein -
  GA721_RS01345 - 295255..295824 (+) 570 WP_160242753.1 pilin -
  GA721_RS01350 tfpZ 295898..296632 (+) 735 WP_005180473.1 TfpX/TfpZ family type IV pilin accessory protein -
  GA721_RS01355 - 296724..298364 (+) 1641 WP_160242754.1 O-antigen ligase family protein -
  GA721_RS01360 - 298461..299612 (-) 1152 WP_160242755.1 IS4-like element ISAbe18 family transposase -
  GA721_RS01365 bfr 299754..300218 (-) 465 WP_005180468.1 bacterioferritin -
  GA721_RS01370 - 300445..300639 (-) 195 WP_034597991.1 bacterioferritin-associated ferredoxin -
  GA721_RS01375 - 300794..301177 (-) 384 WP_104513240.1 RidA family protein -
  GA721_RS01380 - 301249..303348 (-) 2100 WP_160242756.1 RelA/SpoT family protein -
  GA721_RS01385 rpoZ 303572..303853 (-) 282 WP_004809957.1 DNA-directed RNA polymerase subunit omega -
  GA721_RS01390 gmk 303930..304553 (-) 624 WP_045795273.1 guanylate kinase -
  GA721_RS01395 ispH 304689..305639 (+) 951 WP_104489996.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  GA721_RS01400 - 305803..306219 (+) 417 WP_160242757.1 Tfp pilus assembly protein FimT/FimU -
  GA721_RS01405 pilV 306232..306735 (+) 504 WP_160242758.1 type IV pilus modification protein PilV -
  GA721_RS01410 - 306728..307801 (+) 1074 WP_005180447.1 PilW family protein -
  GA721_RS01415 - 307798..308499 (+) 702 WP_160242759.1 pilus assembly protein PilX -
  GA721_RS01420 - 308526..312080 (+) 3555 WP_160242760.1 PilC/PilY family type IV pilus protein -
  GA721_RS01425 - 312082..312627 (+) 546 WP_005180440.1 prepilin-type N-terminal cleavage/methylation domain-containing protein -
  GA721_RS01430 comF 312627..313061 (+) 435 WP_005180438.1 type IV pilin protein Machinery gene
  GA721_RS01435 rpsP 313206..313463 (+) 258 WP_004809941.1 30S ribosomal protein S16 -
  GA721_RS01440 rimM 313492..314040 (+) 549 WP_075167879.1 ribosome maturation factor RimM -
  GA721_RS01445 trmD 314067..314816 (+) 750 WP_160242761.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  GA721_RS01450 rplS 314990..315364 (+) 375 WP_003792460.1 50S ribosomal protein L19 -
  GA721_RS14945 - 315429..315704 (-) 276 WP_225876382.1 hypothetical protein -
  GA721_RS01460 - 315946..316167 (-) 222 WP_216072231.1 esterase/lipase family protein -
  GA721_RS01465 - 316291..317265 (-) 975 WP_104488271.1 lipase family alpha/beta hydrolase -
  GA721_RS01470 - 317353..318339 (-) 987 WP_075174928.1 esterase/lipase family protein -
  GA721_RS01475 - 318751..319779 (-) 1029 WP_160242762.1 lipase secretion chaperone -
  GA721_RS01480 - 319850..320917 (-) 1068 WP_160242763.1 RNA-guided endonuclease InsQ/TnpB family protein -

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 16257.32 Da        Isoelectric Point: 6.7084

>NTDB_id=392162 GA721_RS01430 WP_005180438.1 312627..313061(+) (comF) [Acinetobacter indicus strain TQ18]
MHQNQGFTLIELMIAVAIIGVLAAIAYPSYTEYVKRTNRTDMQGQLLNITYKLQNYKVVNHTYQNATLSVLKVDSTYPST
RLYDIELLVDADGQGYLLKASPNKSKNQKDDGDLCINQEGHKYWKKANTCDSSDLDATTNWDGK

Nucleotide


Download         Length: 435 bp        

>NTDB_id=392162 GA721_RS01430 WP_005180438.1 312627..313061(+) (comF) [Acinetobacter indicus strain TQ18]
ATGCATCAAAATCAAGGGTTTACATTAATTGAATTAATGATTGCTGTGGCAATCATTGGGGTTTTGGCTGCAATTGCGTA
CCCTTCTTATACTGAGTATGTTAAACGTACAAATCGTACAGATATGCAGGGTCAATTGTTAAATATCACGTATAAATTGC
AAAATTATAAAGTTGTAAATCATACCTATCAGAATGCCACCTTATCTGTTTTGAAAGTTGATTCAACCTATCCATCAACA
AGATTATATGATATTGAATTATTAGTCGATGCTGATGGACAAGGTTATTTATTAAAAGCTTCACCTAATAAGAGTAAAAA
TCAAAAAGATGATGGTGACTTGTGTATAAATCAGGAAGGTCATAAATATTGGAAAAAAGCGAATACGTGTGACAGCAGTG
ATTTAGATGCCACAACCAACTGGGACGGCAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)

Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS)

(28-115)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB N9M7I7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comF Acinetobacter baylyi ADP1

50.685

100

0.514
  pilE Acinetobacter baumannii D1279779

38.849

96.528

0.375

Multiple sequence alignment