Detailed information
Bioinformatically predicted
Overview
| Name | HI0659 | Type | Machinery gene |
| Locus tag | LPB220_RS03505 | Genome accession | NZ_CP044230 |
| Coordinates | 657496..657789 (+) | Length | 97 a.a. |
| NCBI ID | WP_021144391.1 | Uniprot ID | - |
| Organism | Streptococcus sp. LPB0220 | ||
| Function | DNA uptake (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 655749..701673 | 657496..657789 | within | 0 |
Gene organization within MGE regions
Location: 655749..701673
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPB220_RS03495 (LPB220_03495) | - | 655749..656975 (+) | 1227 | WP_150905551.1 | restriction endonuclease subunit S | - |
| LPB220_RS03500 (LPB220_03500) | - | 657141..657506 (+) | 366 | WP_049507635.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LPB220_RS03505 (LPB220_03505) | HI0659 | 657496..657789 (+) | 294 | WP_021144391.1 | helix-turn-helix domain-containing protein | Machinery gene |
| LPB220_RS03510 (LPB220_03510) | - | 657811..659412 (+) | 1602 | WP_150905553.1 | type I restriction-modification system subunit M | - |
| LPB220_RS03515 (LPB220_03515) | - | 659528..660439 (+) | 912 | WP_150905555.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| LPB220_RS03520 (LPB220_03520) | - | 660614..661759 (-) | 1146 | WP_150905557.1 | site-specific integrase | - |
| LPB220_RS03525 (LPB220_03525) | - | 661867..662388 (-) | 522 | WP_150905558.1 | hypothetical protein | - |
| LPB220_RS03530 (LPB220_03530) | - | 662405..662782 (-) | 378 | WP_150905560.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LPB220_RS03535 (LPB220_03535) | - | 662779..663132 (-) | 354 | WP_150905562.1 | helix-turn-helix domain-containing protein | - |
| LPB220_RS03540 (LPB220_03540) | - | 663320..663538 (+) | 219 | WP_150905564.1 | helix-turn-helix domain-containing protein | - |
| LPB220_RS03545 (LPB220_03545) | - | 663654..663935 (+) | 282 | WP_150905566.1 | hypothetical protein | - |
| LPB220_RS03550 (LPB220_03550) | - | 663932..664195 (+) | 264 | WP_061455382.1 | hypothetical protein | - |
| LPB220_RS10755 | - | 664185..664358 (+) | 174 | WP_191904620.1 | hypothetical protein | - |
| LPB220_RS03555 (LPB220_03555) | - | 664342..665622 (+) | 1281 | WP_150905568.1 | AAA family ATPase | - |
| LPB220_RS03560 (LPB220_03560) | - | 665641..665988 (+) | 348 | WP_150905570.1 | hypothetical protein | - |
| LPB220_RS03565 (LPB220_03565) | - | 665992..667053 (+) | 1062 | WP_150905572.1 | ATP-binding protein | - |
| LPB220_RS03570 (LPB220_03570) | - | 667075..667638 (+) | 564 | WP_150905574.1 | hypothetical protein | - |
| LPB220_RS03575 (LPB220_03575) | - | 667656..669239 (+) | 1584 | WP_150905576.1 | DEAD/DEAH box helicase | - |
| LPB220_RS03580 (LPB220_03580) | - | 669258..670883 (+) | 1626 | WP_150905578.1 | SIALI-17 repeat-containing surface protein | - |
| LPB220_RS03585 (LPB220_03585) | - | 670893..671666 (+) | 774 | WP_150906785.1 | DNA methyltransferase | - |
| LPB220_RS03590 (LPB220_03590) | - | 671648..673975 (+) | 2328 | WP_150905581.1 | AAA family ATPase | - |
| LPB220_RS10760 | - | 674101..674277 (+) | 177 | WP_191904621.1 | hypothetical protein | - |
| LPB220_RS03595 (LPB220_03595) | - | 674298..674717 (+) | 420 | WP_150905584.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LPB220_RS03600 (LPB220_03600) | - | 674695..674916 (+) | 222 | WP_150905586.1 | hypothetical protein | - |
| LPB220_RS03605 (LPB220_03605) | - | 674913..675164 (+) | 252 | WP_150905588.1 | hypothetical protein | - |
| LPB220_RS03610 (LPB220_03610) | - | 675145..675660 (+) | 516 | WP_150905590.1 | helix-turn-helix domain-containing protein | - |
| LPB220_RS03615 (LPB220_03615) | - | 675657..676148 (+) | 492 | WP_150905592.1 | DUF1642 domain-containing protein | - |
| LPB220_RS03620 (LPB220_03620) | - | 676252..676461 (+) | 210 | WP_150905594.1 | hypothetical protein | - |
| LPB220_RS03625 (LPB220_03625) | - | 676458..676700 (+) | 243 | WP_150905596.1 | hypothetical protein | - |
| LPB220_RS03630 (LPB220_03630) | - | 676697..676897 (+) | 201 | WP_150905598.1 | hypothetical protein | - |
| LPB220_RS03635 (LPB220_03635) | - | 676894..677169 (+) | 276 | WP_150905600.1 | hypothetical protein | - |
| LPB220_RS03640 (LPB220_03640) | - | 677363..677788 (+) | 426 | WP_150905602.1 | hypothetical protein | - |
| LPB220_RS03645 (LPB220_03645) | - | 678111..679169 (+) | 1059 | WP_150905604.1 | DUF4417 domain-containing protein | - |
| LPB220_RS03650 (LPB220_03650) | - | 679159..679611 (+) | 453 | WP_150905606.1 | hypothetical protein | - |
| LPB220_RS03655 (LPB220_03655) | - | 679638..680090 (+) | 453 | WP_150905608.1 | stress-induced protein | - |
| LPB220_RS03660 (LPB220_03660) | - | 680080..681315 (+) | 1236 | WP_150905610.1 | PBSX family phage terminase large subunit | - |
| LPB220_RS03665 (LPB220_03665) | - | 681388..682863 (+) | 1476 | WP_225305934.1 | phage portal protein | - |
| LPB220_RS03670 (LPB220_03670) | - | 682835..683770 (+) | 936 | WP_150905614.1 | minor capsid protein | - |
| LPB220_RS03675 (LPB220_03675) | - | 683912..684124 (+) | 213 | WP_150905616.1 | crAss001_48 related protein | - |
| LPB220_RS03680 (LPB220_03680) | - | 684250..684843 (+) | 594 | WP_150905619.1 | DUF4355 domain-containing protein | - |
| LPB220_RS03685 (LPB220_03685) | - | 684860..685744 (+) | 885 | WP_150905621.1 | phage capsid protein | - |
| LPB220_RS03690 (LPB220_03690) | - | 685763..686128 (+) | 366 | WP_150905622.1 | phage head-tail connector protein | - |
| LPB220_RS03695 (LPB220_03695) | - | 686142..686420 (+) | 279 | WP_150905624.1 | hypothetical protein | - |
| LPB220_RS03700 (LPB220_03700) | - | 686417..686761 (+) | 345 | WP_150905625.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LPB220_RS03705 (LPB220_03705) | - | 686765..687130 (+) | 366 | WP_150905627.1 | hypothetical protein | - |
| LPB220_RS03710 (LPB220_03710) | - | 687148..687729 (+) | 582 | WP_150905628.1 | phage major tail protein, TP901-1 family | - |
| LPB220_RS03715 (LPB220_03715) | - | 687797..688273 (+) | 477 | WP_150905630.1 | tail assembly chaperone | - |
| LPB220_RS10965 (LPB220_03725) | - | 688591..693291 (+) | 4701 | WP_150905632.1 | phage tail tape measure protein | - |
| LPB220_RS03730 (LPB220_03730) | - | 693301..694164 (+) | 864 | WP_150905633.1 | phage tail domain-containing protein | - |
| LPB220_RS03735 (LPB220_03735) | - | 694180..697476 (+) | 3297 | WP_150905635.1 | phage tail protein | - |
| LPB220_RS03740 (LPB220_03740) | - | 697488..697700 (+) | 213 | WP_150905636.1 | hypothetical protein | - |
| LPB220_RS03745 (LPB220_03745) | - | 697707..698327 (+) | 621 | WP_150905638.1 | hypothetical protein | - |
| LPB220_RS03750 (LPB220_03750) | - | 698350..698757 (+) | 408 | WP_225305925.1 | hypothetical protein | - |
| LPB220_RS03755 (LPB220_03755) | - | 698759..699088 (+) | 330 | WP_150905639.1 | phage holin | - |
| LPB220_RS03760 (LPB220_03760) | - | 699100..699945 (+) | 846 | WP_150905641.1 | lytic exoenzyme target recognition domain-containing protein | - |
| LPB220_RS03765 (LPB220_03765) | - | 699957..700421 (+) | 465 | WP_150905643.1 | hypothetical protein | - |
| LPB220_RS03770 (LPB220_03770) | - | 700433..700783 (+) | 351 | WP_150905644.1 | hypothetical protein | - |
| LPB220_RS03775 (LPB220_03775) | - | 700795..701673 (+) | 879 | WP_150905646.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 97 a.a. Molecular weight: 10730.48 Da Isoelectric Point: 5.8962
>NTDB_id=388984 LPB220_RS03505 WP_021144391.1 657496..657789(+) (HI0659) [Streptococcus sp. LPB0220]
MKNSAIGSNWKDVRAELFTKEEILESDLRVAIMTELIEARHEKGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEQEKV
MKNSAIGSNWKDVRAELFTKEEILESDLRVAIMTELIEARHEKGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEQEKV
Nucleotide
Download Length: 294 bp
>NTDB_id=388984 LPB220_RS03505 WP_021144391.1 657496..657789(+) (HI0659) [Streptococcus sp. LPB0220]
ATGAAGAATAGTGCCATCGGCAGCAATTGGAAAGATGTGAGAGCAGAGCTCTTCACCAAGGAAGAAATCCTGGAAAGTGA
TCTGCGGGTCGCGATTATGACAGAGCTGATCGAGGCTCGGCATGAAAAAGGCATTAGCCAAAAGAAACTAGAAGAACTCA
GTGGGGTCAGTCAACCGGTCATCGCTCGGATGGAGACAGGCAAGACCAGTCCACAATTGGACACGGTCTTGAAAGTCTTA
GCTAGTCTGGGCAAGACCCTCGCCGTCGTCCCACTGGAACAAGAAAAGGTCTAA
ATGAAGAATAGTGCCATCGGCAGCAATTGGAAAGATGTGAGAGCAGAGCTCTTCACCAAGGAAGAAATCCTGGAAAGTGA
TCTGCGGGTCGCGATTATGACAGAGCTGATCGAGGCTCGGCATGAAAAAGGCATTAGCCAAAAGAAACTAGAAGAACTCA
GTGGGGTCAGTCAACCGGTCATCGCTCGGATGGAGACAGGCAAGACCAGTCCACAATTGGACACGGTCTTGAAAGTCTTA
GCTAGTCTGGGCAAGACCCTCGCCGTCGTCCCACTGGAACAAGAAAAGGTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| HI0659 | Haemophilus influenzae Rd KW20 |
60.44 |
93.814 |
0.567 |