Detailed information    

insolico Bioinformatically predicted

Overview


Name   rcrR   Type   Regulator
Locus tag   F5989_RS02150 Genome accession   NZ_CP044221
Coordinates   432567..433001 (-) Length   144 a.a.
NCBI ID   WP_002263292.1    Uniprot ID   A0AAX1K4B8
Organism   Streptococcus mutans strain NCH105     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 429017..467166 432567..433001 within 0


Gene organization within MGE regions


Location: 429017..467166
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F5989_RS02140 (F5989_02175) rcrQ 429017..430771 (-) 1755 WP_002263294.1 ABC transporter ATP-binding protein Regulator
  F5989_RS02145 (F5989_02180) rcrP 430761..432563 (-) 1803 WP_002263293.1 ABC transporter ATP-binding protein Regulator
  F5989_RS02150 (F5989_02185) rcrR 432567..433001 (-) 435 WP_002263292.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  F5989_RS02155 (F5989_02190) queC 433553..434206 (+) 654 WP_002263291.1 7-cyano-7-deazaguanine synthase QueC -
  F5989_RS02160 (F5989_02195) queD 434206..434652 (+) 447 WP_002263290.1 6-carboxytetrahydropterin synthase QueD -
  F5989_RS02165 (F5989_02200) queE 434649..435365 (+) 717 WP_002263289.1 7-carboxy-7-deazaguanine synthase QueE -
  F5989_RS02170 (F5989_02205) queF 435378..435866 (+) 489 WP_002265143.1 preQ(1) synthase -
  F5989_RS02175 (F5989_02210) - 435975..436358 (+) 384 WP_002265142.1 DUF3021 family protein -
  F5989_RS02180 (F5989_02215) gdhA 436470..437819 (-) 1350 WP_002263849.1 NADP-specific glutamate dehydrogenase -
  F5989_RS02185 (F5989_02220) - 438514..439020 (+) 507 WP_002266553.1 DUF308 domain-containing protein -
  F5989_RS02190 (F5989_02225) gtfD 439243..443631 (-) 4389 WP_002289671.1 glucosyltransferase-S -
  F5989_RS02195 (F5989_02230) - 443852..444772 (-) 921 WP_002289669.1 AEC family transporter -
  F5989_RS02200 (F5989_02235) - 444889..446661 (-) 1773 WP_002289667.1 ABC transporter ATP-binding protein -
  F5989_RS02205 (F5989_02240) - 446672..448408 (-) 1737 WP_002289665.1 ABC transporter ATP-binding protein -
  F5989_RS02210 (F5989_02245) - 448864..450732 (-) 1869 WP_002289664.1 ABC-F family ATP-binding cassette domain-containing protein -
  F5989_RS02215 (F5989_02250) - 450735..451940 (-) 1206 WP_002289663.1 CCA tRNA nucleotidyltransferase -
  F5989_RS02220 (F5989_02255) dapB 451937..452704 (-) 768 WP_002262893.1 4-hydroxy-tetrahydrodipicolinate reductase -
  F5989_RS02225 (F5989_02260) - 452716..453561 (-) 846 WP_002266545.1 DegV family protein -
  F5989_RS02230 (F5989_02265) - 453567..453941 (-) 375 WP_002262891.1 DUF1149 family protein -
  F5989_RS02235 (F5989_02270) - 454050..455591 (-) 1542 WP_002274053.1 hypothetical protein -
  F5989_RS10385 (F5989_02275) - 455578..456294 (-) 717 Protein_423 ABC transporter ATP-binding protein -
  F5989_RS02245 (F5989_02280) - 456369..456974 (-) 606 WP_002274052.1 TetR/AcrR family transcriptional regulator -
  F5989_RS02250 (F5989_02285) - 457137..457640 (-) 504 WP_002289658.1 phosphatase PAP2 family protein -
  F5989_RS02255 (F5989_02290) - 457882..458961 (-) 1080 WP_002271491.1 serine hydrolase domain-containing protein -
  F5989_RS02260 (F5989_02295) galE 459227..460228 (-) 1002 WP_002289656.1 UDP-glucose 4-epimerase GalE -
  F5989_RS02265 (F5989_02300) galT 460377..461852 (-) 1476 WP_002289654.1 UDP-glucose--hexose-1-phosphate uridylyltransferase -
  F5989_RS02270 (F5989_02305) - 461857..463029 (-) 1173 WP_002289653.1 galactokinase -
  F5989_RS02275 (F5989_02310) - 463172..464170 (+) 999 WP_002289652.1 LacI family DNA-binding transcriptional regulator -
  F5989_RS02280 (F5989_02315) dexB 464332..465942 (-) 1611 WP_002272969.1 glucan 1,6-alpha-glucosidase DexB -
  F5989_RS02285 (F5989_02320) - 466033..467166 (-) 1134 WP_002269398.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 144 a.a.        Molecular weight: 16720.58 Da        Isoelectric Point: 10.5126

>NTDB_id=388819 F5989_RS02150 WP_002263292.1 432567..433001(-) (rcrR) [Streptococcus mutans strain NCH105]
MKEPFSEFKNLITATERYIQELSKSHGVEHLSGPQGWTVMFLKDNQGKEIFIKDIEKRLDISKSVTSNLIKRMEKNGFIS
VIPSRKDRRYKQIVLTPLGQEKAGKITVFLTDLKKLLLKDISQEDLSVARKVFKQIKQNLEKKE

Nucleotide


Download         Length: 435 bp        

>NTDB_id=388819 F5989_RS02150 WP_002263292.1 432567..433001(-) (rcrR) [Streptococcus mutans strain NCH105]
ATGAAGGAGCCTTTTAGTGAATTTAAAAACCTCATTACAGCAACAGAAAGATATATTCAAGAATTATCCAAAAGCCATGG
TGTTGAACATCTGTCCGGACCTCAGGGATGGACAGTTATGTTTTTAAAGGATAATCAAGGAAAGGAAATTTTTATTAAAG
ATATTGAAAAAAGGTTAGATATCTCAAAATCTGTGACCAGTAATCTCATTAAACGAATGGAAAAAAATGGTTTTATTTCT
GTTATTCCTTCCAGAAAAGACAGACGATACAAGCAAATTGTTTTAACGCCATTAGGTCAGGAAAAAGCTGGAAAAATAAC
TGTTTTTTTAACAGATCTTAAAAAGTTGCTTCTAAAAGATATTAGTCAGGAAGACTTATCAGTTGCTCGGAAGGTTTTTA
AACAAATCAAACAAAATTTAGAAAAGAAGGAGTAA

Domains


Predicted by InterproScan.

(31-89)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

100

100

1


Multiple sequence alignment