Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   HIR76_RS13375 Genome accession   NZ_CP051860
Coordinates   2575912..2576085 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2570912..2581085
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HIR76_RS13360 (HIR76_14245) gcvT 2571711..2572799 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  HIR76_RS13365 (HIR76_14240) hepAA 2573241..2574914 (+) 1674 WP_004398544.1 SNF2-related protein -
  HIR76_RS13370 (HIR76_14235) yqhG 2574935..2575729 (+) 795 WP_003230200.1 YqhG family protein -
  HIR76_RS13375 (HIR76_14230) sinI 2575912..2576085 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HIR76_RS13380 (HIR76_14225) sinR 2576119..2576454 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HIR76_RS13385 (HIR76_14220) aph(3')-IIIa 2576692..2577486 (-) 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
  HIR76_RS13390 (HIR76_14215) - 2577579..2578068 (-) 490 Protein_2604 GNAT family N-acetyltransferase -
  HIR76_RS13395 (HIR76_14210) sipW 2578040..2578612 (-) 573 WP_003246088.1 signal peptidase I SipW -
  HIR76_RS13400 (HIR76_14205) tapA 2578596..2579357 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  HIR76_RS13405 (HIR76_14200) yqzG 2579629..2579955 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HIR76_RS13410 (HIR76_14195) spoIITA 2579997..2580176 (-) 180 WP_003230176.1 YqzE family protein -
  HIR76_RS13415 (HIR76_14190) comGG 2580247..2580621 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  HIR76_RS13420 (HIR76_14185) comGF 2580622..2581005 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=388310 HIR76_RS13375 WP_003230187.1 2575912..2576085(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=388310 HIR76_RS13375 WP_003230187.1 2575912..2576085(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1