Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   F4V41_RS04605 Genome accession   NZ_CP044143
Coordinates   592261..592890 (-) Length   209 a.a.
NCBI ID   WP_000839159.1    Uniprot ID   A0AAV3HCB2
Organism   Escherichia coli O157 strain AR-0429     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 581184..604064 592261..592890 within 0


Gene organization within MGE regions


Location: 581184..604064
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F4V41_RS04545 - 581184..582203 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  F4V41_RS04550 yccA 582611..583270 (+) 660 WP_000375128.1 FtsH protease modulator YccA -
  F4V41_RS04555 tusE 583361..583690 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  F4V41_RS04560 yccX 583687..583964 (-) 278 Protein_664 acylphosphatase -
  F4V41_RS04565 rlmI 584059..585249 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  F4V41_RS04570 hspQ 585307..585624 (+) 318 WP_001295356.1 heat shock protein HspQ -
  F4V41_RS04575 yccU 585669..586082 (-) 414 WP_000665217.1 CoA-binding protein -
  F4V41_RS04580 yccT 586255..586917 (+) 663 WP_000847791.1 DUF2057 family protein -
  F4V41_RS04585 mgsA 587013..587471 (+) 459 WP_000424181.1 methylglyoxal synthase -
  F4V41_RS04590 helD 587503..589557 (-) 2055 WP_001301436.1 DNA helicase IV -
  F4V41_RS04595 yccF 589680..590126 (+) 447 WP_001261230.1 YccF domain-containing protein -
  F4V41_RS04600 yccS 590136..592298 (+) 2163 WP_000875023.1 YccS family putative transporter -
  F4V41_RS04605 sxy/tfoX 592261..592890 (-) 630 WP_000839159.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  F4V41_RS04610 sulA 593109..593618 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  F4V41_RS04615 ompA 593975..595015 (+) 1041 WP_000750416.1 porin OmpA -
  F4V41_RS04620 matP 595091..595543 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  F4V41_RS04625 ycbZ 595729..597489 (+) 1761 WP_000156526.1 Lon protease family protein -
  F4V41_RS04630 fabA 597558..598076 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  F4V41_RS04635 rmf 598146..598313 (-) 168 WP_000828648.1 ribosome modulation factor -
  F4V41_RS04640 pqiC 598569..599132 (-) 564 WP_000759107.1 membrane integrity-associated transporter subunit PqiC -
  F4V41_RS04645 pqiB 599129..600769 (-) 1641 WP_000445550.1 intermembrane transport protein PqiB -
  F4V41_RS04650 pqiA 600774..602027 (-) 1254 WP_000333170.1 membrane integrity-associated transporter subunit PqiA -
  F4V41_RS04655 uup 602157..604064 (-) 1908 WP_000053083.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24173.05 Da        Isoelectric Point: 9.1942

>NTDB_id=388251 F4V41_RS04605 WP_000839159.1 592261..592890(-) (sxy/tfoX) [Escherichia coli O157 strain AR-0429]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKYPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=388251 F4V41_RS04605 WP_000839159.1 592261..592890(-) (sxy/tfoX) [Escherichia coli O157 strain AR-0429]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAATATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995


Multiple sequence alignment