Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   F4V42_RS01865 Genome accession   NZ_CP044140
Coordinates   62058..62687 (-) Length   209 a.a.
NCBI ID   WP_000839159.1    Uniprot ID   A0AAV3HCB2
Organism   Escherichia coli O157 strain AR-0430     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 50980..73861 62058..62687 within 0


Gene organization within MGE regions


Location: 50980..73861
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F4V42_RS01805 - 50980..51999 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  F4V42_RS01810 yccA 52407..53066 (+) 660 WP_000375128.1 FtsH protease modulator YccA -
  F4V42_RS01815 tusE 53157..53486 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  F4V42_RS01820 yccX 53483..53761 (-) 279 WP_000048252.1 acylphosphatase -
  F4V42_RS01825 rlmI 53856..55046 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  F4V42_RS01830 hspQ 55104..55421 (+) 318 WP_001295356.1 heat shock protein HspQ -
  F4V42_RS01835 yccU 55466..55879 (-) 414 WP_000665217.1 CoA-binding protein -
  F4V42_RS01840 yccT 56052..56714 (+) 663 WP_000847791.1 DUF2057 family protein -
  F4V42_RS01845 mgsA 56810..57268 (+) 459 WP_000424181.1 methylglyoxal synthase -
  F4V42_RS01850 helD 57300..59354 (-) 2055 WP_001301436.1 DNA helicase IV -
  F4V42_RS01855 yccF 59477..59923 (+) 447 WP_001261230.1 YccF domain-containing protein -
  F4V42_RS01860 yccS 59933..62095 (+) 2163 WP_000875023.1 YccS family putative transporter -
  F4V42_RS01865 sxy/tfoX 62058..62687 (-) 630 WP_000839159.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  F4V42_RS01870 sulA 62906..63415 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  F4V42_RS01875 ompA 63772..64812 (+) 1041 WP_000750416.1 porin OmpA -
  F4V42_RS01880 matP 64888..65340 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  F4V42_RS01885 ycbZ 65526..67286 (+) 1761 WP_000156526.1 Lon protease family protein -
  F4V42_RS01890 fabA 67355..67873 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  F4V42_RS01895 rmf 67943..68110 (-) 168 WP_000828648.1 ribosome modulation factor -
  F4V42_RS01900 pqiC 68366..68929 (-) 564 WP_000759107.1 membrane integrity-associated transporter subunit PqiC -
  F4V42_RS01905 pqiB 68926..70566 (-) 1641 WP_000445550.1 intermembrane transport protein PqiB -
  F4V42_RS01910 pqiA 70571..71824 (-) 1254 WP_000333170.1 membrane integrity-associated transporter subunit PqiA -
  F4V42_RS01915 uup 71954..73861 (-) 1908 WP_000053083.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24173.05 Da        Isoelectric Point: 9.1942

>NTDB_id=388228 F4V42_RS01865 WP_000839159.1 62058..62687(-) (sxy/tfoX) [Escherichia coli O157 strain AR-0430]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKYPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=388228 F4V42_RS01865 WP_000839159.1 62058..62687(-) (sxy/tfoX) [Escherichia coli O157 strain AR-0430]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAATATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995


Multiple sequence alignment