Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   F0T12_RS02335 Genome accession   NZ_CP043812
Coordinates   451196..451669 (+) Length   157 a.a.
NCBI ID   WP_174813111.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain NG290     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 452215..502612 451196..451669 flank 546


Gene organization within MGE regions


Location: 451196..502612
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F0T12_RS02335 (F0T12_02625) pilL 451196..451669 (+) 474 WP_174813111.1 PilX family type IV pilin Machinery gene
  F0T12_RS02340 (F0T12_02635) - 452281..452726 (-) 446 Protein_458 AzlC family ABC transporter permease -
  F0T12_RS02345 (F0T12_02640) dut 452892..453344 (+) 453 WP_050303745.1 dUTP diphosphatase -
  F0T12_RS02350 (F0T12_02645) dapC 453422..454609 (+) 1188 WP_164823235.1 succinyldiaminopimelate transaminase -
  F0T12_RS02355 (F0T12_02650) yaaA 454920..455699 (+) 780 WP_003694987.1 peroxide stress protein YaaA -
  F0T12_RS02370 (F0T12_02665) - 456230..457426 (+) 1197 WP_017147117.1 tyrosine-type recombinase/integrase -
  F0T12_RS02375 (F0T12_02675) - 457782..458051 (-) 270 WP_003687928.1 hypothetical protein -
  F0T12_RS02380 (F0T12_02680) - 458246..458929 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  F0T12_RS12880 - 459210..459476 (-) 267 Protein_465 hypothetical protein -
  F0T12_RS02390 (F0T12_02690) - 459587..459802 (-) 216 WP_003691538.1 hypothetical protein -
  F0T12_RS02395 (F0T12_02695) - 459854..460345 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  F0T12_RS02400 (F0T12_02700) - 460342..460524 (-) 183 WP_003691535.1 hypothetical protein -
  F0T12_RS02405 (F0T12_02705) - 460664..461350 (-) 687 WP_082278088.1 phage replication initiation protein, NGO0469 family -
  F0T12_RS02410 (F0T12_02710) - 461419..461580 (-) 162 WP_003693867.1 hypothetical protein -
  F0T12_RS02415 (F0T12_02715) - 461577..461852 (-) 276 WP_047918704.1 NGO1622 family putative holin -
  F0T12_RS02420 (F0T12_02720) - 462005..462337 (-) 333 WP_003695500.1 hypothetical protein -
  F0T12_RS02425 (F0T12_02725) - 462478..462765 (-) 288 WP_050157611.1 hypothetical protein -
  F0T12_RS02430 (F0T12_02730) - 462762..463238 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  F0T12_RS02435 (F0T12_02735) - 463271..463471 (-) 201 WP_003692842.1 hypothetical protein -
  F0T12_RS02440 (F0T12_02740) - 463669..464082 (-) 414 WP_003687963.1 hypothetical protein -
  F0T12_RS02445 (F0T12_02745) - 464079..464540 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  F0T12_RS02450 (F0T12_02750) - 464557..464994 (-) 438 WP_003687967.1 hypothetical protein -
  F0T12_RS02455 (F0T12_02755) - 465107..465823 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  F0T12_RS02460 (F0T12_02760) - 465898..466128 (+) 231 WP_020997318.1 transcriptional regulator -
  F0T12_RS02465 (F0T12_02765) - 466208..466363 (+) 156 WP_003689578.1 hypothetical protein -
  F0T12_RS02470 (F0T12_02770) - 466340..466528 (-) 189 WP_050157615.1 hypothetical protein -
  F0T12_RS02475 (F0T12_02775) - 466701..466928 (+) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  F0T12_RS02480 (F0T12_02780) - 466925..467935 (+) 1011 WP_164823237.1 helix-turn-helix domain-containing protein -
  F0T12_RS02485 (F0T12_02785) - 467949..468731 (+) 783 WP_033910919.1 ATP-binding protein -
  F0T12_RS02490 (F0T12_02790) - 468744..469007 (+) 264 WP_174813108.1 hypothetical protein -
  F0T12_RS02495 (F0T12_02795) - 469045..469539 (+) 495 WP_041421248.1 DUF3310 domain-containing protein -
  F0T12_RS02500 (F0T12_02800) - 469716..469865 (+) 150 WP_003692854.1 hypothetical protein -
  F0T12_RS12320 - 469894..470175 (+) 282 WP_003689109.1 hypothetical protein -
  F0T12_RS02505 (F0T12_02805) - 470166..470546 (+) 381 WP_033910829.1 RusA family crossover junction endodeoxyribonuclease -
  F0T12_RS02510 (F0T12_02815) - 470813..471220 (+) 408 WP_047922557.1 hypothetical protein -
  F0T12_RS02515 (F0T12_02820) - 471281..472240 (+) 960 WP_123768253.1 hypothetical protein -
  F0T12_RS02520 (F0T12_02825) - 472531..473358 (+) 828 WP_050157519.1 KilA-N domain-containing protein -
  F0T12_RS02525 (F0T12_02830) - 473651..474100 (+) 450 WP_003695485.1 hypothetical protein -
  F0T12_RS02530 (F0T12_02835) terL 474162..475583 (+) 1422 WP_003697216.1 phage terminase large subunit -
  F0T12_RS02535 (F0T12_02840) - 475580..477727 (+) 2148 WP_050157516.1 phage portal protein -
  F0T12_RS02540 (F0T12_02845) - 477795..478952 (+) 1158 WP_050157513.1 HK97 family phage prohead protease -
  F0T12_RS02545 (F0T12_02850) - 478993..480492 (+) 1500 WP_050157511.1 hypothetical protein -
  F0T12_RS11960 (F0T12_02855) - 480499..480861 (+) 363 WP_003689082.1 hypothetical protein -
  F0T12_RS02555 (F0T12_02860) - 480864..481394 (+) 531 WP_003689080.1 head-tail connector protein -
  F0T12_RS02560 (F0T12_02865) - 481394..481876 (+) 483 WP_050157509.1 HK97 gp10 family phage protein -
  F0T12_RS02565 (F0T12_02870) - 481873..482301 (+) 429 WP_003689076.1 hypothetical protein -
  F0T12_RS02570 (F0T12_02875) - 482327..483100 (+) 774 WP_003691416.1 hypothetical protein -
  F0T12_RS02575 (F0T12_02880) - 483161..483490 (+) 330 WP_003689072.1 hypothetical protein -
  F0T12_RS02580 (F0T12_02885) - 483502..483768 (+) 267 WP_003689070.1 hypothetical protein -
  F0T12_RS02585 (F0T12_02890) - 483768..484367 (+) 600 WP_003691415.1 DUF2460 domain-containing protein -
  F0T12_RS02590 (F0T12_02895) - 484364..485218 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  F0T12_RS02595 (F0T12_02900) - 485220..485651 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  F0T12_RS02600 (F0T12_02905) - 485679..485957 (-) 279 WP_003689062.1 helix-turn-helix domain-containing protein -
  F0T12_RS02605 (F0T12_02910) - 486197..490342 (+) 4146 WP_050157506.1 phage tail protein -
  F0T12_RS02610 (F0T12_02915) - 490454..490759 (+) 306 WP_003689058.1 hypothetical protein -
  F0T12_RS02615 (F0T12_02920) - 490830..491300 (+) 471 WP_003689057.1 hypothetical protein -
  F0T12_RS02620 (F0T12_02925) - 491301..491633 (+) 333 WP_003691408.1 hypothetical protein -
  F0T12_RS02625 (F0T12_02930) - 491999..492346 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  F0T12_RS02630 (F0T12_02935) - 492346..492582 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  F0T12_RS12730 - 492622..492747 (+) 126 WP_255294325.1 hypothetical protein -
  F0T12_RS02635 (F0T12_02945) - 492789..493328 (+) 540 WP_104691775.1 TIGR02594 family protein -
  F0T12_RS02640 (F0T12_02950) - 493329..493673 (+) 345 WP_003695464.1 hypothetical protein -
  F0T12_RS02645 - 493657..493830 (+) 174 WP_164823238.1 hypothetical protein -
  F0T12_RS02650 (F0T12_02955) - 494142..494291 (+) 150 WP_003691402.1 hypothetical protein -
  F0T12_RS02655 (F0T12_02960) - 494321..497368 (+) 3048 WP_050157602.1 tape measure protein -
  F0T12_RS02660 (F0T12_02965) - 497428..497907 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  F0T12_RS02665 (F0T12_02975) - 498249..499238 (-) 990 WP_003689040.1 tyrosine-type recombinase/integrase -
  F0T12_RS02670 (F0T12_02980) - 499498..499686 (-) 189 WP_003689039.1 hypothetical protein -
  F0T12_RS02675 (F0T12_02985) purM 499927..500961 (+) 1035 WP_003691398.1 phosphoribosylformylglycinamidine cyclo-ligase -
  F0T12_RS02685 (F0T12_02990) - 501959..502612 (+) 654 WP_164823810.1 IS1595 family transposase -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17536.40 Da        Isoelectric Point: 9.8238

>NTDB_id=385908 F0T12_RS02335 WP_174813111.1 451196..451669(+) (pilL) [Neisseria gonorrhoeae strain NG290]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNVGTGYTLSVWMNSVGDGYKCRDAASAKTYKEQLSGDGGCEALSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=385908 F0T12_RS02335 WP_174813111.1 451196..451669(+) (pilL) [Neisseria gonorrhoeae strain NG290]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGTGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGACCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

89.172

100

0.892
  pilX Neisseria meningitidis 8013

85.35

100

0.854

Multiple sequence alignment