Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG578_RS00200 Genome accession   NZ_CP051537
Coordinates   37336..37449 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain LIM-005     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32336..42449
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG578_RS00175 (HG578_00175) - 32377..34605 (+) 2229 WP_187924265.1 ATP-dependent Clp protease ATP-binding subunit -
  HG578_RS00180 (HG578_00180) panD 34595..34948 (+) 354 WP_077642785.1 aspartate 1-decarboxylase -
  HG578_RS00185 (HG578_00185) - 34951..35253 (+) 303 WP_000347931.1 YbaB/EbfC family nucleoid-associated protein -
  HG578_RS00190 (HG578_00190) - 35253..36257 (+) 1005 WP_202134815.1 PDZ domain-containing protein -
  HG578_RS00195 (HG578_00195) comB6 36265..37320 (+) 1056 WP_202135161.1 P-type conjugative transfer protein TrbL Machinery gene
  HG578_RS00200 (HG578_00200) comB7 37336..37449 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HG578_RS00205 (HG578_00205) comB8 37446..38189 (+) 744 WP_165536104.1 virB8 family protein Machinery gene
  HG578_RS00210 (HG578_00210) comB9 38189..39172 (+) 984 WP_164531543.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG578_RS00215 (HG578_00215) comB10 39165..40295 (+) 1131 WP_202134816.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG578_RS00220 (HG578_00220) - 40366..41778 (+) 1413 WP_202134817.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=385337 HG578_RS00200 WP_001217873.1 37336..37449(+) (comB7) [Helicobacter pylori strain LIM-005]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=385337 HG578_RS00200 WP_001217873.1 37336..37449(+) (comB7) [Helicobacter pylori strain LIM-005]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1