Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG580_RS00195 Genome accession   NZ_CP051536
Coordinates   33555..33668 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   -
Organism   Helicobacter pylori strain LIM-007     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 28555..38668
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG580_RS00170 - 28603..30825 (+) 2223 WP_202145897.1 ATP-dependent Clp protease ATP-binding subunit -
  HG580_RS00175 panD 30815..31165 (+) 351 WP_128033521.1 aspartate 1-decarboxylase -
  HG580_RS00180 - 31176..31469 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HG580_RS00185 - 31469..32476 (+) 1008 WP_202146370.1 PDZ domain-containing protein -
  HG580_RS00190 comB6 32484..33539 (+) 1056 WP_202146369.1 P-type conjugative transfer protein TrbL Machinery gene
  HG580_RS00195 comB7 33555..33668 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HG580_RS00200 comB8 33665..34408 (+) 744 WP_202145898.1 virB8 family protein Machinery gene
  HG580_RS00205 comB9 34408..35367 (+) 960 WP_202145899.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG580_RS00210 comB10 35360..36496 (+) 1137 WP_202145900.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG580_RS00215 - 36566..37978 (+) 1413 WP_202145901.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=385297 HG580_RS00195 WP_001217868.1 33555..33668(+) (comB7) [Helicobacter pylori strain LIM-007]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=385297 HG580_RS00195 WP_001217868.1 33555..33668(+) (comB7) [Helicobacter pylori strain LIM-007]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919