Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   F0M21_RS02020 Genome accession   NZ_CP043546
Coordinates   397251..397370 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SYP-B637     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 392251..402370
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F0M21_RS02005 (F0M21_02005) - 393863..394546 (+) 684 WP_007410267.1 response regulator transcription factor -
  F0M21_RS02010 (F0M21_02010) - 394533..395966 (+) 1434 WP_162303988.1 HAMP domain-containing sensor histidine kinase -
  F0M21_RS02015 (F0M21_02015) rapC 396119..397267 (+) 1149 WP_012116798.1 Rap family tetratricopeptide repeat protein Regulator
  F0M21_RS02020 (F0M21_02020) phrC 397251..397370 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  F0M21_RS02025 (F0M21_02025) - 397519..397629 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  F0M21_RS02030 (F0M21_02030) - 397709..399073 (-) 1365 WP_012116801.1 aspartate kinase -
  F0M21_RS02035 (F0M21_02035) ceuB 399487..400440 (+) 954 WP_012116802.1 ABC transporter permease Machinery gene
  F0M21_RS02040 (F0M21_02040) - 400430..401377 (+) 948 WP_012116803.1 iron chelate uptake ABC transporter family permease subunit -
  F0M21_RS02045 (F0M21_02045) - 401371..402129 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=384948 F0M21_RS02020 WP_003156334.1 397251..397370(+) (phrC) [Bacillus velezensis strain SYP-B637]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=384948 F0M21_RS02020 WP_003156334.1 397251..397370(+) (phrC) [Bacillus velezensis strain SYP-B637]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment