Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG561_RS00195 Genome accession   NZ_CP051506
Coordinates   33642..33755 (+) Length   37 a.a.
NCBI ID   WP_001217864.1    Uniprot ID   -
Organism   Helicobacter pylori strain SHIM-007     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 28642..38755
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG561_RS00170 (HG561_00170) - 28681..30903 (+) 2223 WP_202168487.1 ATP-dependent Clp protease ATP-binding subunit -
  HG561_RS00175 (HG561_00175) panD 30893..31243 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  HG561_RS00180 (HG561_00180) - 31254..31556 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HG561_RS00185 (HG561_00185) - 31556..32563 (+) 1008 WP_202168857.1 PDZ domain-containing protein -
  HG561_RS00190 (HG561_00190) comB6 32571..33626 (+) 1056 WP_000786690.1 P-type conjugative transfer protein TrbL Machinery gene
  HG561_RS00195 (HG561_00195) comB7 33642..33755 (+) 114 WP_001217864.1 hypothetical protein Machinery gene
  HG561_RS00200 (HG561_00200) comB8 33752..34495 (+) 744 WP_000660502.1 virB8 family protein Machinery gene
  HG561_RS00205 (HG561_00205) comB9 34495..35451 (+) 957 WP_202168488.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG561_RS00210 (HG561_00210) comB10 35444..36580 (+) 1137 WP_202168489.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG561_RS00215 (HG561_00215) - 36650..38062 (+) 1413 WP_000694822.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=384926 HG561_RS00195 WP_001217864.1 33642..33755(+) (comB7) [Helicobacter pylori strain SHIM-007]
MRIFFVIIGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=384926 HG561_RS00195 WP_001217864.1 33642..33755(+) (comB7) [Helicobacter pylori strain SHIM-007]
ATGAGAATTTTTTTTGTTATTATAGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892