Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG564_RS00195 Genome accession   NZ_CP051503
Coordinates   33618..33731 (+) Length   37 a.a.
NCBI ID   WP_001218100.1    Uniprot ID   -
Organism   Helicobacter pylori strain SHIM-014     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 28618..38731
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG564_RS00170 (HG564_00170) - 28678..30900 (+) 2223 WP_202171889.1 ATP-dependent Clp protease ATP-binding subunit -
  HG564_RS00175 (HG564_00175) panD 30890..31240 (+) 351 WP_000142269.1 aspartate 1-decarboxylase -
  HG564_RS00180 (HG564_00180) - 31251..31544 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HG564_RS00185 (HG564_00185) - 31544..32539 (+) 996 WP_202172301.1 PDZ domain-containing protein -
  HG564_RS00190 (HG564_00190) comB6 32547..33602 (+) 1056 WP_202172300.1 P-type conjugative transfer protein TrbL Machinery gene
  HG564_RS00195 (HG564_00195) comB7 33618..33731 (+) 114 WP_001218100.1 hypothetical protein Machinery gene
  HG564_RS00200 (HG564_00200) comB8 33728..34471 (+) 744 WP_202171890.1 virB8 family protein Machinery gene
  HG564_RS00205 (HG564_00205) comB9 34471..35427 (+) 957 WP_014662053.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG564_RS00210 (HG564_00210) comB10 35420..36556 (+) 1137 WP_001045877.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG564_RS00215 (HG564_00215) - 36626..38038 (+) 1413 WP_202171891.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4263.19 Da        Isoelectric Point: 9.3572

>NTDB_id=384804 HG564_RS00195 WP_001218100.1 33618..33731(+) (comB7) [Helicobacter pylori strain SHIM-014]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=384804 HG564_RS00195 WP_001218100.1 33618..33731(+) (comB7) [Helicobacter pylori strain SHIM-014]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892


Multiple sequence alignment