Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG567_RS00200 Genome accession   NZ_CP051500
Coordinates   37321..37434 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   -
Organism   Helicobacter pylori strain PUNO-003     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32321..42434
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG567_RS00175 (HG567_00175) - 32365..34590 (+) 2226 WP_202163832.1 ATP-dependent Clp protease ATP-binding subunit -
  HG567_RS00180 (HG567_00180) panD 34580..34933 (+) 354 WP_000142250.1 aspartate 1-decarboxylase -
  HG567_RS00185 (HG567_00185) - 34936..35238 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HG567_RS00190 (HG567_00190) - 35238..36242 (+) 1005 WP_202140206.1 PDZ domain-containing protein -
  HG567_RS00195 (HG567_00195) comB6 36250..37305 (+) 1056 WP_202140205.1 P-type conjugative transfer protein TrbL Machinery gene
  HG567_RS00200 (HG567_00200) comB7 37321..37434 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HG567_RS00205 (HG567_00205) comB8 37431..38174 (+) 744 WP_202139739.1 virB8 family protein Machinery gene
  HG567_RS00210 (HG567_00210) comB9 38174..39154 (+) 981 WP_202139740.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG567_RS00215 (HG567_00215) comB10 39147..40283 (+) 1137 WP_202139741.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG567_RS00220 (HG567_00220) - 40353..41750 (+) 1398 WP_202139742.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=384683 HG567_RS00200 WP_001217868.1 37321..37434(+) (comB7) [Helicobacter pylori strain PUNO-003]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=384683 HG567_RS00200 WP_001217868.1 37321..37434(+) (comB7) [Helicobacter pylori strain PUNO-003]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919


Multiple sequence alignment