Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG569_RS00205 Genome accession   NZ_CP051498
Coordinates   35757..35870 (+) Length   37 a.a.
NCBI ID   WP_202272694.1    Uniprot ID   -
Organism   Helicobacter pylori strain PUNO-006     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30757..40870
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG569_RS00180 (HG569_00180) - 30805..33027 (+) 2223 WP_202272693.1 ATP-dependent Clp protease ATP-binding subunit -
  HG569_RS00185 (HG569_00185) panD 33017..33367 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  HG569_RS00190 (HG569_00190) - 33378..33671 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HG569_RS00195 (HG569_00195) - 33671..34678 (+) 1008 WP_202273158.1 PDZ domain-containing protein -
  HG569_RS00200 (HG569_00200) comB6 34686..35741 (+) 1056 WP_202273157.1 P-type conjugative transfer protein TrbL Machinery gene
  HG569_RS00205 (HG569_00205) comB7 35757..35870 (+) 114 WP_202272694.1 comB7 lipoprotein Machinery gene
  HG569_RS00210 (HG569_00210) comB8 35867..36610 (+) 744 WP_202272695.1 virB8 family protein Machinery gene
  HG569_RS00215 (HG569_00215) comB9 36610..37575 (+) 966 WP_202272696.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG569_RS00220 (HG569_00220) comB10 37568..38704 (+) 1137 WP_202272697.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG569_RS00225 (HG569_00225) - 38774..40186 (+) 1413 WP_202272698.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=384609 HG569_RS00205 WP_202272694.1 35757..35870(+) (comB7) [Helicobacter pylori strain PUNO-006]
MRIFFVIMGIMLFGCTSKVHEIKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=384609 HG569_RS00205 WP_202272694.1 35757..35870(+) (comB7) [Helicobacter pylori strain PUNO-006]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATAAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892