Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG571_RS00200 Genome accession   NZ_CP051496
Coordinates   35527..35640 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   -
Organism   Helicobacter pylori strain PUNO-008     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30527..40640
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG571_RS00175 (HG571_00175) - 30575..32797 (+) 2223 WP_202140757.1 ATP-dependent Clp protease ATP-binding subunit -
  HG571_RS00180 (HG571_00180) panD 32787..33137 (+) 351 WP_202140758.1 aspartate 1-decarboxylase -
  HG571_RS00185 (HG571_00185) - 33148..33441 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HG571_RS00190 (HG571_00190) - 33441..34448 (+) 1008 WP_202141218.1 PDZ domain-containing protein -
  HG571_RS00195 (HG571_00195) comB6 34456..35511 (+) 1056 WP_202141217.1 P-type conjugative transfer protein TrbL Machinery gene
  HG571_RS00200 (HG571_00200) comB7 35527..35640 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HG571_RS00205 (HG571_00205) comB8 35637..36380 (+) 744 WP_000660502.1 virB8 family protein Machinery gene
  HG571_RS00210 (HG571_00210) comB9 36380..37330 (+) 951 WP_202140759.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG571_RS00215 (HG571_00215) comB10 37323..38459 (+) 1137 WP_202140760.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG571_RS00220 (HG571_00220) - 38529..39941 (+) 1413 WP_202140761.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=384527 HG571_RS00200 WP_001217868.1 35527..35640(+) (comB7) [Helicobacter pylori strain PUNO-008]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=384527 HG571_RS00200 WP_001217868.1 35527..35640(+) (comB7) [Helicobacter pylori strain PUNO-008]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACACTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919