Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG573_RS00200 Genome accession   NZ_CP051494
Coordinates   37433..37546 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain PUNO-010     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32433..42546
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG573_RS00175 (HG573_00175) - 32478..34706 (+) 2229 WP_202147354.1 ATP-dependent Clp protease ATP-binding subunit -
  HG573_RS00180 (HG573_00180) panD 34696..35046 (+) 351 WP_000142242.1 aspartate 1-decarboxylase -
  HG573_RS00185 (HG573_00185) - 35057..35359 (+) 303 WP_187868973.1 YbaB/EbfC family nucleoid-associated protein -
  HG573_RS00190 (HG573_00190) - 35359..36354 (+) 996 WP_202147809.1 PDZ domain-containing protein -
  HG573_RS00195 (HG573_00195) comB6 36362..37417 (+) 1056 WP_077367089.1 P-type conjugative transfer protein TrbL Machinery gene
  HG573_RS00200 (HG573_00200) comB7 37433..37546 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HG573_RS00205 (HG573_00205) comB8 37543..38286 (+) 744 WP_079356717.1 virB8 family protein Machinery gene
  HG573_RS00210 (HG573_00210) comB9 38286..39263 (+) 978 WP_202147355.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG573_RS00215 (HG573_00215) comB10 39256..40386 (+) 1131 WP_202147356.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG573_RS00220 (HG573_00220) - 40456..41868 (+) 1413 WP_202147357.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=384441 HG573_RS00200 WP_001217873.1 37433..37546(+) (comB7) [Helicobacter pylori strain PUNO-010]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=384441 HG573_RS00200 WP_001217873.1 37433..37546(+) (comB7) [Helicobacter pylori strain PUNO-010]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1