Detailed information
Bioinformatically predicted
Overview
| Name | pilJ | Type | Machinery gene |
| Locus tag | BSR23_RS27415 | Genome accession | NZ_CP043422 |
| Coordinates | 1839460..1839570 (-) | Length | 36 a.a. |
| NCBI ID | WP_269467447.1 | Uniprot ID | - |
| Organism | Vibrio parahaemolyticus strain MVP1 | ||
| Function | type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1838505..1874080 | 1839460..1839570 | within | 0 |
Gene organization within MGE regions
Location: 1838505..1874080
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSR23_RS26170 (BSR23_026170) | - | 1838505..1839011 (-) | 507 | WP_149144417.1 | CSS-motif domain-containing protein | - |
| BSR23_RS27415 | pilJ | 1839460..1839570 (-) | 111 | WP_269467447.1 | methyl-accepting chemotaxis protein | Machinery gene |
| BSR23_RS26180 (BSR23_026180) | - | 1840614..1840838 (-) | 225 | WP_149144418.1 | hypothetical protein | - |
| BSR23_RS26185 (BSR23_026185) | tnpA | 1840989..1841411 (-) | 423 | WP_031855796.1 | IS200/IS605 family transposase | - |
| BSR23_RS26190 (BSR23_026190) | - | 1841659..1842558 (-) | 900 | WP_149144419.1 | methyl-accepting chemotaxis protein | - |
| BSR23_RS26195 (BSR23_026195) | - | 1842808..1844010 (-) | 1203 | WP_407058122.1 | OmpP1/FadL family transporter | - |
| BSR23_RS26200 (BSR23_026200) | - | 1845258..1845950 (-) | 693 | WP_031855792.1 | ATP-binding protein | - |
| BSR23_RS26205 (BSR23_026205) | istA | 1845961..1847450 (-) | 1490 | Protein_1610 | IS21 family transposase | - |
| BSR23_RS26215 (BSR23_026215) | - | 1848761..1849681 (-) | 921 | WP_031855791.1 | IS5-like element ISVpa3 family transposase | - |
| BSR23_RS27565 | - | 1849840..1850235 (-) | 396 | WP_407058126.1 | CZB domain-containing protein | - |
| BSR23_RS27570 | - | 1850272..1850778 (-) | 507 | Protein_1613 | methyl-accepting chemotaxis protein | - |
| BSR23_RS26225 (BSR23_026225) | - | 1851124..1851351 (-) | 228 | WP_139833613.1 | hypothetical protein | - |
| BSR23_RS26230 (BSR23_026230) | - | 1851362..1852405 (-) | 1044 | WP_031855789.1 | CfaE/CblD family pilus tip adhesin | - |
| BSR23_RS26235 (BSR23_026235) | - | 1852474..1852779 (-) | 306 | WP_149144421.1 | hypothetical protein | - |
| BSR23_RS26240 (BSR23_026240) | - | 1852721..1853239 (-) | 519 | WP_187614830.1 | hypothetical protein | - |
| BSR23_RS27575 (BSR23_026245) | - | 1853901..1854023 (-) | 123 | WP_149144440.1 | TcfC E-set like domain-containing protein | - |
| BSR23_RS26250 (BSR23_026250) | - | 1854039..1854635 (-) | 597 | WP_149144423.1 | hypothetical protein | - |
| BSR23_RS26255 (BSR23_026255) | - | 1854907..1855392 (-) | 486 | WP_149144424.1 | CS1 type fimbrial major subunit | - |
| BSR23_RS26260 (BSR23_026260) | - | 1855724..1856080 (-) | 357 | WP_149144425.1 | hypothetical protein | - |
| BSR23_RS26265 (BSR23_026265) | - | 1856400..1856668 (+) | 269 | Protein_1622 | transposase | - |
| BSR23_RS26270 (BSR23_026270) | - | 1856891..1857923 (-) | 1033 | Protein_1623 | IS110 family transposase | - |
| BSR23_RS26275 (BSR23_026275) | - | 1857992..1858487 (+) | 496 | Protein_1624 | IS3 family transposase | - |
| BSR23_RS26280 (BSR23_026280) | - | 1858563..1860112 (+) | 1550 | WP_373415650.1 | IS3 family transposase | - |
| BSR23_RS26285 (BSR23_026285) | - | 1860132..1860599 (+) | 468 | Protein_1626 | IS3 family transposase | - |
| BSR23_RS27580 (BSR23_026290) | - | 1861081..1861482 (-) | 402 | WP_407058127.1 | transglutaminase-like cysteine peptidase | - |
| BSR23_RS27585 | - | 1862209..1862349 (-) | 141 | WP_222929179.1 | hypothetical protein | - |
| BSR23_RS27590 | - | 1862333..1862527 (-) | 195 | WP_222929180.1 | EAL domain-containing protein | - |
| BSR23_RS26305 (BSR23_026305) | - | 1864850..1866961 (-) | 2112 | WP_149144428.1 | adhesion domain-containing protein | - |
| BSR23_RS26315 (BSR23_026315) | - | 1867321..1867629 (-) | 309 | WP_149144430.1 | hypothetical protein | - |
| BSR23_RS26320 (BSR23_026320) | - | 1867626..1868720 (-) | 1095 | WP_031856297.1 | hypothetical protein | - |
| BSR23_RS26325 (BSR23_026325) | - | 1869079..1869315 (-) | 237 | WP_149144431.1 | hypothetical protein | - |
| BSR23_RS26330 (BSR23_026330) | - | 1869437..1869721 (-) | 285 | WP_149144432.1 | hypothetical protein | - |
| BSR23_RS26335 (BSR23_026335) | - | 1870265..1870969 (-) | 705 | WP_149144433.1 | hypothetical protein | - |
| BSR23_RS27595 (BSR23_026340) | - | 1871059..1871313 (-) | 255 | WP_149144441.1 | TcfC E-set like domain-containing protein | - |
| BSR23_RS26345 (BSR23_026345) | - | 1871343..1871843 (-) | 501 | WP_149144434.1 | hypothetical protein | - |
| BSR23_RS26350 (BSR23_026350) | - | 1871952..1872176 (-) | 225 | WP_149144435.1 | hypothetical protein | - |
| BSR23_RS26355 (BSR23_026355) | - | 1872806..1873360 (-) | 555 | WP_031856292.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 36 a.a. Molecular weight: 3978.59 Da Isoelectric Point: 4.2645
>NTDB_id=383945 BSR23_RS27415 WP_269467447.1 1839460..1839570(-) (pilJ) [Vibrio parahaemolyticus strain MVP1]
MRIYSDEISTVLDMIESISEQTNLLALNAAIKAPRA
MRIYSDEISTVLDMIESISEQTNLLALNAAIKAPRA
Nucleotide
Download Length: 111 bp
>NTDB_id=383945 BSR23_RS27415 WP_269467447.1 1839460..1839570(-) (pilJ) [Vibrio parahaemolyticus strain MVP1]
TTGAGGATTTATTCGGATGAAATAAGTACTGTTTTAGATATGATTGAATCGATATCTGAACAGACGAATTTGTTAGCGTT
AAATGCAGCAATTAAAGCTCCAAGAGCGTGA
TTGAGGATTTATTCGGATGAAATAAGTACTGTTTTAGATATGATTGAATCGATATCTGAACAGACGAATTTGTTAGCGTT
AAATGCAGCAATTAAAGCTCCAAGAGCGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilJ | Synechocystis sp. PCC 6803 |
56.25 |
88.889 |
0.5 |