Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   HC659_RS12160 Genome accession   NZ_CP051465
Coordinates   2396943..2397326 (-) Length   127 a.a.
NCBI ID   WP_032722118.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain UCMB5121     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2391943..2402326
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HC659_RS12120 (HC659_23960) sinI 2392876..2393049 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HC659_RS12125 (HC659_23970) sinR 2393083..2393418 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HC659_RS12130 (HC659_23980) tasA 2393511..2394296 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  HC659_RS12135 (HC659_23990) sipW 2394360..2394932 (-) 573 WP_072692741.1 signal peptidase I SipW -
  HC659_RS12140 (HC659_24000) tapA 2394916..2395677 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  HC659_RS12145 (HC659_24010) yqzG 2395949..2396275 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HC659_RS12150 (HC659_24020) spoIITA 2396317..2396496 (-) 180 WP_029726723.1 YqzE family protein -
  HC659_RS12155 (HC659_24030) comGG 2396568..2396942 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  HC659_RS12160 (HC659_24040) comGF 2396943..2397326 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  HC659_RS12165 (HC659_24050) comGE 2397352..2397699 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  HC659_RS12170 (HC659_24060) comGD 2397683..2398114 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  HC659_RS12175 (HC659_24070) comGC 2398104..2398400 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  HC659_RS12180 (HC659_24080) comGB 2398414..2399451 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  HC659_RS12185 (HC659_24090) comGA 2399438..2400508 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  HC659_RS12190 (HC659_24110) - 2400721..2400918 (-) 198 WP_014480259.1 CBS domain-containing protein -
  HC659_RS12195 (HC659_24120) corA 2400920..2401873 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14375.50 Da        Isoelectric Point: 5.8940

>NTDB_id=383744 HC659_RS12160 WP_032722118.1 2396943..2397326(-) (comGF) [Bacillus subtilis subsp. subtilis strain UCMB5121]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=383744 HC659_RS12160 WP_032722118.1 2396943..2397326(-) (comGF) [Bacillus subtilis subsp. subtilis strain UCMB5121]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment