Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   HC659_RS12120 Genome accession   NZ_CP051465
Coordinates   2392876..2393049 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis strain UCMB5121     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2387876..2398049
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HC659_RS12105 (HC659_23930) gcvT 2388675..2389763 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  HC659_RS12110 (HC659_23940) hepAA 2390205..2391878 (+) 1674 WP_029726726.1 SNF2-related protein -
  HC659_RS12115 (HC659_23950) yqhG 2391899..2392693 (+) 795 WP_015714249.1 YqhG family protein -
  HC659_RS12120 (HC659_23960) sinI 2392876..2393049 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HC659_RS12125 (HC659_23970) sinR 2393083..2393418 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HC659_RS12130 (HC659_23980) tasA 2393511..2394296 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  HC659_RS12135 (HC659_23990) sipW 2394360..2394932 (-) 573 WP_072692741.1 signal peptidase I SipW -
  HC659_RS12140 (HC659_24000) tapA 2394916..2395677 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  HC659_RS12145 (HC659_24010) yqzG 2395949..2396275 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HC659_RS12150 (HC659_24020) spoIITA 2396317..2396496 (-) 180 WP_029726723.1 YqzE family protein -
  HC659_RS12155 (HC659_24030) comGG 2396568..2396942 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  HC659_RS12160 (HC659_24040) comGF 2396943..2397326 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  HC659_RS12165 (HC659_24050) comGE 2397352..2397699 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=383741 HC659_RS12120 WP_003230187.1 2392876..2393049(+) (sinI) [Bacillus subtilis subsp. subtilis strain UCMB5121]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=383741 HC659_RS12120 WP_003230187.1 2392876..2393049(+) (sinI) [Bacillus subtilis subsp. subtilis strain UCMB5121]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment