Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   HC659_RS06050 Genome accession   NZ_CP051465
Coordinates   1185423..1185614 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain UCMB5121     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1180423..1190614
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HC659_RS06020 (HC659_11920) argF 1181288..1182247 (+) 960 WP_032721338.1 ornithine carbamoyltransferase -
  HC659_RS06025 (HC659_11930) yjzC 1182333..1182512 (+) 180 WP_003245356.1 YjzC family protein -
  HC659_RS06030 (HC659_11940) yjzD 1182558..1182743 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  HC659_RS06035 (HC659_11950) - 1182992..1183726 (+) 735 WP_032721340.1 hypothetical protein -
  HC659_RS06040 (HC659_11960) - 1183808..1184365 (+) 558 WP_089172508.1 hypothetical protein -
  HC659_RS06045 (HC659_11970) med 1184455..1185408 (+) 954 WP_089172509.1 transcriptional regulator Med Regulator
  HC659_RS06050 (HC659_11980) comZ 1185423..1185614 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  HC659_RS06055 (HC659_11990) yjzB 1185644..1185883 (-) 240 WP_003232972.1 spore coat protein YjzB -
  HC659_RS06060 (HC659_12000) fabH 1186048..1186986 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  HC659_RS06065 (HC659_12010) fabF 1187009..1188250 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  HC659_RS06070 (HC659_12020) yjaZ 1188326..1189111 (+) 786 WP_032721346.1 DUF2268 domain-containing protein -
  HC659_RS06075 (HC659_12030) appD 1189303..1190289 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=383697 HC659_RS06050 WP_003224559.1 1185423..1185614(+) (comZ) [Bacillus subtilis subsp. subtilis strain UCMB5121]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=383697 HC659_RS06050 WP_003224559.1 1185423..1185614(+) (comZ) [Bacillus subtilis subsp. subtilis strain UCMB5121]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterProScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment