Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BSUW23_RS15725 Genome accession   NC_014479
Coordinates   3040519..3040659 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus spizizenii str. W23     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3035519..3045659
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSUW23_RS15700 (BSUW23_15400) - 3035843..3036223 (-) 381 WP_003220719.1 hotdog fold thioesterase -
  BSUW23_RS15705 (BSUW23_15405) comA 3036239..3036883 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSUW23_RS15710 (BSUW23_15410) comP 3036964..3039288 (-) 2325 WP_003220714.1 histidine kinase Regulator
  BSUW23_RS15715 (BSUW23_15415) comX 3039296..3039460 (-) 165 WP_003220712.1 competence pheromone ComX -
  BSUW23_RS15720 (BSUW23_15420) - 3039473..3040333 (-) 861 WP_003220710.1 polyprenyl synthetase family protein -
  BSUW23_RS15725 (BSUW23_15425) degQ 3040519..3040659 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSUW23_RS21350 - 3040891..3041007 (+) 117 WP_136975871.1 hypothetical protein -
  BSUW23_RS15730 (BSUW23_15430) - 3041122..3041490 (+) 369 WP_013308041.1 hypothetical protein -
  BSUW23_RS15735 (BSUW23_15435) pdeH 3041466..3042695 (-) 1230 WP_003220696.1 cyclic di-GMP phosphodiesterase -
  BSUW23_RS15740 (BSUW23_15440) - 3042830..3044302 (-) 1473 WP_003220693.1 nicotinate phosphoribosyltransferase -
  BSUW23_RS15745 (BSUW23_15445) - 3044318..3044869 (-) 552 WP_003220692.1 cysteine hydrolase family protein -
  BSUW23_RS15750 (BSUW23_15450) - 3044966..3045364 (-) 399 WP_003220689.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=38217 BSUW23_RS15725 WP_003220708.1 3040519..3040659(-) (degQ) [Bacillus spizizenii str. W23]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=38217 BSUW23_RS15725 WP_003220708.1 3040519..3040659(-) (degQ) [Bacillus spizizenii str. W23]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment