Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   HCN55_RS17120 Genome accession   NZ_CP050532
Coordinates   3252707..3252874 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis subsp. subtilis str. SMY     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3247707..3257874
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCN55_RS17090 (HCN55_17100) mrpE 3248102..3248578 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  HCN55_RS17095 (HCN55_17105) mrpF 3248578..3248862 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  HCN55_RS17100 (HCN55_17110) mnhG 3248846..3249220 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  HCN55_RS17105 (HCN55_17115) yuxO 3249259..3249639 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  HCN55_RS17110 (HCN55_17120) comA 3249658..3250302 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  HCN55_RS17115 (HCN55_17125) comP 3250383..3252692 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  HCN55_RS17120 (HCN55_17130) comX 3252707..3252874 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  HCN55_RS17125 (HCN55_17135) comQ 3252862..3253761 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  HCN55_RS17130 (HCN55_17140) degQ 3253946..3254086 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  HCN55_RS17135 (HCN55_17145) - 3254308..3254433 (+) 126 WP_003228793.1 hypothetical protein -
  HCN55_RS17140 (HCN55_17150) - 3254547..3254915 (+) 369 WP_003243784.1 hypothetical protein -
  HCN55_RS17145 (HCN55_17155) pdeH 3254891..3256120 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  HCN55_RS17150 (HCN55_17160) pncB 3256257..3257729 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=381405 HCN55_RS17120 WP_003242801.1 3252707..3252874(-) (comX) [Bacillus subtilis subsp. subtilis str. SMY]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=381405 HCN55_RS17120 WP_003242801.1 3252707..3252874(-) (comX) [Bacillus subtilis subsp. subtilis str. SMY]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment