Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   FED50_RS15275 Genome accession   NZ_CP042929
Coordinates   2648221..2648499 (+) Length   92 a.a.
NCBI ID   WP_088054487.1    Uniprot ID   -
Organism   Bacillus cereus strain G1-1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2637510..2679314 2648221..2648499 within 0


Gene organization within MGE regions


Location: 2637510..2679314
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FED50_RS15195 - 2637510..2637773 (+) 264 WP_002082716.1 DUF3937 domain-containing protein -
  FED50_RS15200 - 2638329..2638649 (+) 321 WP_001071364.1 heterocycloanthracin/sonorensin family bacteriocin -
  FED50_RS30860 - 2638826..2638929 (+) 104 Protein_2596 site-specific integrase -
  FED50_RS15205 - 2639139..2639624 (+) 486 WP_002025857.1 hypothetical protein -
  FED50_RS15210 - 2639936..2640637 (+) 702 WP_063536437.1 DUF3962 domain-containing protein -
  FED50_RS15215 - 2640676..2641785 (-) 1110 WP_088054496.1 tyrosine-type recombinase/integrase -
  FED50_RS15220 - 2641990..2642172 (+) 183 WP_088054495.1 hypothetical protein -
  FED50_RS15225 - 2642676..2643869 (+) 1194 WP_144653380.1 AimR family lysis-lysogeny pheromone receptor -
  FED50_RS30660 - 2643910..2644062 (+) 153 WP_000723681.1 hypothetical protein -
  FED50_RS30665 - 2644220..2644357 (+) 138 WP_176359967.1 hypothetical protein -
  FED50_RS15230 - 2644387..2644746 (-) 360 WP_000427704.1 helix-turn-helix transcriptional regulator -
  FED50_RS15235 - 2644918..2645121 (+) 204 WP_044797971.1 helix-turn-helix transcriptional regulator -
  FED50_RS15245 - 2645326..2645592 (+) 267 WP_044797972.1 helix-turn-helix domain-containing protein -
  FED50_RS30670 - 2645592..2645756 (+) 165 WP_000390297.1 hypothetical protein -
  FED50_RS30675 - 2645786..2645962 (+) 177 WP_044797974.1 hypothetical protein -
  FED50_RS15250 - 2645967..2646713 (+) 747 WP_088054492.1 DnaD domain protein -
  FED50_RS15255 - 2646682..2647485 (+) 804 WP_088054491.1 ATP-binding protein -
  FED50_RS15260 - 2647501..2647704 (+) 204 WP_088054490.1 hypothetical protein -
  FED50_RS15265 - 2647701..2647928 (-) 228 WP_088054489.1 hypothetical protein -
  FED50_RS15270 - 2648009..2648203 (+) 195 WP_088054488.1 hypothetical protein -
  FED50_RS15275 abrB 2648221..2648499 (+) 279 WP_088054487.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  FED50_RS15280 - 2648492..2648851 (+) 360 WP_088054486.1 cell division protein SepF -
  FED50_RS15285 - 2648870..2649037 (+) 168 WP_000717825.1 DUF3954 domain-containing protein -
  FED50_RS15290 - 2649063..2649314 (+) 252 WP_088054485.1 helix-turn-helix domain containing protein -
  FED50_RS15295 - 2649335..2649817 (+) 483 WP_144653378.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  FED50_RS15300 - 2650114..2650308 (-) 195 WP_088054483.1 hypothetical protein -
  FED50_RS15305 - 2652158..2652844 (-) 687 WP_088054420.1 CPBP family glutamic-type intramembrane protease -
  FED50_RS15310 - 2653465..2654121 (+) 657 WP_088054421.1 hypothetical protein -
  FED50_RS30680 - 2654281..2654451 (+) 171 WP_069461646.1 hypothetical protein -
  FED50_RS15315 - 2654479..2654961 (+) 483 WP_088054422.1 ArpU family phage packaging/lysis transcriptional regulator -
  FED50_RS15320 - 2654961..2655503 (+) 543 WP_088054423.1 site-specific integrase -
  FED50_RS15325 - 2655717..2656667 (+) 951 WP_139846801.1 nucleoside hydrolase -
  FED50_RS15330 - 2657267..2657956 (+) 690 WP_088054425.1 hypothetical protein -
  FED50_RS15335 - 2658554..2659747 (+) 1194 WP_144653374.1 PIN-like domain-containing protein -
  FED50_RS15340 - 2659941..2660204 (+) 264 WP_088054443.1 hypothetical protein -
  FED50_RS15345 - 2660191..2660403 (+) 213 WP_088054427.1 hypothetical protein -
  FED50_RS15350 - 2660541..2660879 (+) 339 WP_088054428.1 HNH endonuclease signature motif containing protein -
  FED50_RS15355 - 2661032..2661367 (+) 336 WP_000124842.1 P27 family phage terminase small subunit -
  FED50_RS15360 - 2661364..2663022 (+) 1659 WP_000615659.1 terminase TerL endonuclease subunit -
  FED50_RS15365 - 2663088..2664194 (+) 1107 WP_088054444.1 phage portal protein -
  FED50_RS15370 - 2664178..2664960 (+) 783 WP_088054429.1 head maturation protease, ClpP-related -
  FED50_RS15375 - 2664964..2666118 (+) 1155 WP_088054430.1 phage major capsid protein -
  FED50_RS15380 - 2666124..2666417 (+) 294 WP_088054431.1 hypothetical protein -
  FED50_RS15385 - 2666419..2666772 (+) 354 WP_030028310.1 phage head closure protein -
  FED50_RS15390 - 2666774..2667115 (+) 342 WP_088054432.1 HK97 gp10 family phage protein -
  FED50_RS15395 - 2667115..2667444 (+) 330 WP_088054433.1 hypothetical protein -
  FED50_RS15400 - 2667445..2668032 (+) 588 WP_088054434.1 major tail protein -
  FED50_RS15405 - 2668037..2668399 (+) 363 WP_088054435.1 hypothetical protein -
  FED50_RS30685 - 2668453..2668614 (+) 162 WP_000477714.1 hypothetical protein -
  FED50_RS15410 - 2668627..2670090 (+) 1464 Protein_2643 phage tail tape measure protein -
  FED50_RS15415 - 2670318..2672483 (+) 2166 WP_088054437.1 phage tail tape measure protein -
  FED50_RS15420 - 2672525..2674000 (+) 1476 WP_088054438.1 distal tail protein Dit -
  FED50_RS15425 - 2673997..2678031 (+) 4035 WP_088054439.1 phage tail spike protein -
  FED50_RS15430 - 2678071..2678496 (+) 426 WP_088054440.1 phage holin family protein -
  FED50_RS15435 - 2678496..2679314 (+) 819 WP_088054441.1 GH25 family lysozyme -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10112.76 Da        Isoelectric Point: 6.4640

>NTDB_id=379432 FED50_RS15275 WP_088054487.1 2648221..2648499(+) (abrB) [Bacillus cereus strain G1-1]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALNFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=379432 FED50_RS15275 WP_088054487.1 2648221..2648499(+) (abrB) [Bacillus cereus strain G1-1]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGATGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAAATTTTCATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TTACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-50)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

60.92

94.565

0.576

Multiple sequence alignment