Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPGAM_RS00200 Genome accession   NC_017371
Coordinates   37760..37873 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   -
Organism   Helicobacter pylori Gambia94/24     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32760..42873
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPGAM_RS00175 (HPGAM_00160) - 32801..35029 (+) 2229 WP_000357191.1 AAA family ATPase -
  HPGAM_RS00180 (HPGAM_00165) panD 35019..35372 (+) 354 WP_000142253.1 aspartate 1-decarboxylase -
  HPGAM_RS00185 (HPGAM_00170) - 35375..35677 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HPGAM_RS00190 (HPGAM_00175) - 35677..36681 (+) 1005 WP_000965847.1 PDZ domain-containing protein -
  HPGAM_RS00195 (HPGAM_00180) comB6 36689..37744 (+) 1056 WP_000679707.1 P-type conjugative transfer protein TrbL Machinery gene
  HPGAM_RS00200 (HPGAM_00185) comB7 37760..37873 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  HPGAM_RS00205 (HPGAM_00190) comB8 37870..38613 (+) 744 WP_000660560.1 type IV secretion system protein Machinery gene
  HPGAM_RS00210 (HPGAM_00195) comB9 38613..39599 (+) 987 WP_014535912.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPGAM_RS00215 (HPGAM_00200) comB10 39592..40722 (+) 1131 WP_001045764.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPGAM_RS00220 (HPGAM_00205) - 40792..42204 (+) 1413 WP_000694972.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=37941 HPGAM_RS00200 WP_001217877.1 37760..37873(+) (comB7) [Helicobacter pylori Gambia94/24]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=37941 HPGAM_RS00200 WP_001217877.1 37760..37873(+) (comB7) [Helicobacter pylori Gambia94/24]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment