Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPF16_RS06590 Genome accession   NC_017368
Coordinates   1345017..1345142 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori F16     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1340017..1350142
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPF16_RS06570 (HPF16_1279) - 1340713..1342116 (-) 1404 WP_000694849.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPF16_RS06575 (HPF16_1280) comB10 1342186..1343322 (-) 1137 WP_001045778.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPF16_RS06580 (HPF16_1281) comB9 1343315..1344277 (-) 963 WP_014535885.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPF16_RS06585 (HPF16_1282) comB8 1344277..1345020 (-) 744 WP_000660524.1 type IV secretion system protein Machinery gene
  HPF16_RS06590 comB7 1345017..1345142 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  HPF16_RS06595 (HPF16_1283) comB6 1345158..1346213 (-) 1056 WP_000786708.1 P-type conjugative transfer protein TrbL Machinery gene
  HPF16_RS06600 (HPF16_1284) - 1346219..1347214 (-) 996 WP_000468437.1 PDZ domain-containing protein -
  HPF16_RS06605 (HPF16_1285) - 1347214..1347507 (-) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  HPF16_RS06610 (HPF16_1286) panD 1347518..1347868 (-) 351 WP_000142207.1 aspartate 1-decarboxylase -
  HPF16_RS06615 (HPF16_1287) - 1347858..1350080 (-) 2223 WP_001051528.1 AAA family ATPase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=37930 HPF16_RS06590 WP_001217874.1 1345017..1345142(-) (comB7) [Helicobacter pylori F16]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=37930 HPF16_RS06590 WP_001217874.1 1345017..1345142(-) (comB7) [Helicobacter pylori F16]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment