Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPF57_RS06715 Genome accession   NC_017367
Coordinates   1378786..1378911 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori F57     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1373786..1383911
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPF57_RS06695 (HPF57_1303) - 1374473..1375885 (-) 1413 WP_000694853.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPF57_RS06700 (HPF57_1304) comB10 1375955..1377091 (-) 1137 WP_001045735.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPF57_RS06705 (HPF57_1305) comB9 1377084..1378046 (-) 963 WP_014535671.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPF57_RS06710 (HPF57_1306) comB8 1378046..1378789 (-) 744 WP_000660531.1 type IV secretion system protein Machinery gene
  HPF57_RS06715 comB7 1378786..1378911 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  HPF57_RS06720 (HPF57_1307) comB6 1378927..1379982 (-) 1056 WP_000786642.1 P-type conjugative transfer protein TrbL Machinery gene
  HPF57_RS06725 (HPF57_1308) - 1379990..1380985 (-) 996 WP_000468801.1 PDZ domain-containing protein -
  HPF57_RS06730 (HPF57_1309) - 1380985..1381278 (-) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  HPF57_RS06735 (HPF57_1310) panD 1381289..1381639 (-) 351 WP_000142267.1 aspartate 1-decarboxylase -
  HPF57_RS06740 (HPF57_1311) - 1381629..1383851 (-) 2223 WP_001051536.1 AAA family ATPase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=37891 HPF57_RS06715 WP_001217874.1 1378786..1378911(-) (comB7) [Helicobacter pylori F57]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=37891 HPF57_RS06715 WP_001217874.1 1378786..1378911(-) (comB7) [Helicobacter pylori F57]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAATAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment