Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   FUT81_RS16565 Genome accession   NZ_CP042813
Coordinates   2902882..2903112 (+) Length   76 a.a.
NCBI ID   WP_353933738.1    Uniprot ID   -
Organism   Treponema phagedenis strain S11.1     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Genomic Context


Location: 2897882..2908112
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FUT81_RS13020 (FUT81_13020) - 2898126..2898704 (+) 579 WP_024752145.1 hypothetical protein -
  FUT81_RS13025 (FUT81_13025) - 2898689..2899270 (+) 582 WP_024752144.1 hypothetical protein -
  FUT81_RS13030 (FUT81_13030) - 2899375..2900010 (+) 636 WP_162147450.1 cysteine peptidase family C39 domain-containing protein -
  FUT81_RS13035 (FUT81_13035) - 2900004..2900837 (+) 834 WP_024752142.1 hypothetical protein -
  FUT81_RS13040 (FUT81_13040) - 2901168..2901764 (+) 597 WP_148879232.1 hypothetical protein -
  FUT81_RS13045 (FUT81_13045) - 2902130..2902732 (+) 603 WP_148879233.1 hypothetical protein -
  FUT81_RS16565 (FUT81_13050) nucA/comI 2902882..2903112 (+) 231 WP_353933738.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  FUT81_RS13055 (FUT81_13055) - 2903115..2903684 (+) 570 WP_148879234.1 DUF6707 family protein -
  FUT81_RS13060 (FUT81_13060) - 2903705..2904109 (+) 405 WP_187426433.1 hypothetical protein -
  FUT81_RS13065 (FUT81_13065) - 2904177..2904866 (+) 690 WP_148879235.1 hypothetical protein -
  FUT81_RS13070 (FUT81_13070) - 2904972..2905700 (+) 729 WP_148879236.1 hypothetical protein -
  FUT81_RS13075 (FUT81_13075) - 2906284..2906475 (+) 192 WP_148879237.1 hypothetical protein -
  FUT81_RS13080 (FUT81_13080) - 2906581..2907171 (+) 591 WP_044634832.1 hypothetical protein -
  FUT81_RS13085 (FUT81_13085) - 2907292..2907996 (+) 705 WP_044634831.1 DUF2971 domain-containing protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8277.53 Da        Isoelectric Point: 8.8285

>NTDB_id=378726 FUT81_RS16565 WP_353933738.1 2902882..2903112(+) (nucA/comI) [Treponema phagedenis strain S11.1]
MDKLNAASRRAESLKGVPIQKGLDRDEWPMAMFMEGGKGASVRHITPADNRGAGAAIMHALKGEERGTRVLFEIID

Nucleotide


Download         Length: 231 bp        

>NTDB_id=378726 FUT81_RS16565 WP_353933738.1 2902882..2903112(+) (nucA/comI) [Treponema phagedenis strain S11.1]
ATTGACAAACTAAACGCTGCAAGTCGTCGTGCAGAATCTCTGAAAGGAGTTCCAATACAAAAGGGACTAGACAGAGATGA
GTGGCCTATGGCTATGTTTATGGAGGGAGGTAAAGGAGCTAGTGTTAGACATATAACCCCAGCAGATAACAGAGGCGCTG
GTGCCGCAATTATGCATGCCTTGAAAGGTGAAGAAAGAGGAACGAGAGTTCTGTTTGAAATAATTGATTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

59.459

97.368

0.579


Multiple sequence alignment