Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   HB750_RS07310 Genome accession   NZ_CP050273
Coordinates   1492349..1492579 (-) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans strain P1     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1487349..1497579
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HB750_RS07285 (HB750_07285) - 1487379..1487900 (+) 522 WP_002264875.1 YgjV family protein -
  HB750_RS07290 (HB750_07290) - 1488007..1488828 (-) 822 WP_032505481.1 Cof-type HAD-IIB family hydrolase -
  HB750_RS07295 (HB750_07295) copZ 1489074..1489277 (-) 204 WP_002263706.1 copper chaperone CopZ -
  HB750_RS07300 (HB750_07300) - 1489290..1491518 (-) 2229 WP_019323085.1 heavy metal translocating P-type ATPase -
  HB750_RS07305 (HB750_07305) - 1491515..1491958 (-) 444 WP_002264871.1 CopY/TcrY family copper transport repressor -
  HB750_RS07310 (HB750_07310) cipB 1492349..1492579 (-) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  HB750_RS07315 (HB750_07315) rbfA 1493058..1493408 (-) 351 WP_002262599.1 30S ribosome-binding factor RbfA -
  HB750_RS07320 (HB750_07320) infB 1493642..1495864 (-) 2223 Protein_1443 translation initiation factor IF-2 -
  HB750_RS10525 - 1496297..1496392 (-) 96 Protein_1444 translation initiation factor IF-2 N-terminal domain-containing protein -
  HB750_RS07325 (HB750_07325) - 1496413..1496715 (-) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  HB750_RS07330 (HB750_07330) rnpM 1496708..1497004 (-) 297 WP_002263922.1 RNase P modulator RnpM -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=378027 HB750_RS07310 WP_002275977.1 1492349..1492579(-) (cipB) [Streptococcus mutans strain P1]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=378027 HB750_RS07310 WP_002275977.1 1492349..1492579(-) (cipB) [Streptococcus mutans strain P1]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCATTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395