Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPLT_RS08590 Genome accession   NC_017362
Coordinates   37701..37814 (+) Length   37 a.a.
NCBI ID   WP_001217848.1    Uniprot ID   -
Organism   Helicobacter pylori Lithuania75     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32701..42814
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPLT_RS00185 (HPLT_00165) - 32744..34969 (+) 2226 WP_001051482.1 AAA family ATPase -
  HPLT_RS00190 (HPLT_00170) panD 34959..35312 (+) 354 WP_000142223.1 aspartate 1-decarboxylase -
  HPLT_RS00195 (HPLT_00175) - 35315..35617 (+) 303 WP_000347930.1 YbaB/EbfC family nucleoid-associated protein -
  HPLT_RS00200 (HPLT_00180) - 35617..36621 (+) 1005 WP_000468482.1 PDZ domain-containing protein -
  HPLT_RS00205 - 36629..37685 (+) 1057 Protein_35 type IV secretion system protein -
  HPLT_RS08590 (HPLT_00195) comB7 37701..37814 (+) 114 WP_001217848.1 hypothetical protein Machinery gene
  HPLT_RS00215 (HPLT_00200) comB8 37811..38554 (+) 744 WP_000660510.1 type IV secretion system protein Machinery gene
  HPLT_RS00220 (HPLT_00205) comB9 38554..39522 (+) 969 WP_014534909.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPLT_RS00225 (HPLT_00210) comB10 39515..40651 (+) 1137 WP_001045898.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPLT_RS00230 (HPLT_00215) - 40721..42139 (+) 1419 WP_000694867.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4339.28 Da        Isoelectric Point: 9.3572

>NTDB_id=37775 HPLT_RS08590 WP_001217848.1 37701..37814(+) (comB7) [Helicobacter pylori Lithuania75]
MRIFFIIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=37775 HPLT_RS08590 WP_001217848.1 37701..37814(+) (comB7) [Helicobacter pylori Lithuania75]
ATGAGAATTTTTTTTATTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment