Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   FQV73_RS15885 Genome accession   NZ_CP042271
Coordinates   3244731..3244850 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain LPL061     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 3239731..3249850
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FQV73_RS15870 - 3241343..3242026 (+) 684 WP_015388707.1 response regulator transcription factor -
  FQV73_RS15875 - 3242013..3243446 (+) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  FQV73_RS15880 rapC 3243599..3244747 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  FQV73_RS15885 phrC 3244731..3244850 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  FQV73_RS15890 - 3245001..3245096 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  FQV73_RS15895 - 3245191..3246555 (-) 1365 WP_014304341.1 aspartate kinase -
  FQV73_RS15900 ceuB 3246970..3247923 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  FQV73_RS15905 - 3247913..3248860 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  FQV73_RS15910 - 3248854..3249612 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=376569 FQV73_RS15885 WP_003156334.1 3244731..3244850(+) (phrC) [Bacillus velezensis strain LPL061]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=376569 FQV73_RS15885 WP_003156334.1 3244731..3244850(+) (phrC) [Bacillus velezensis strain LPL061]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment